KEGG   Gallus gallus (chicken): 419571
Entry
419571            CDS       T01006                                 

Gene name
KDM1A
Definition
(RefSeq) lysine-specific histone demethylase 1A isoform X2
  KO
K11450  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase [EC:1.14.99.66]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    419571 (KDM1A)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.66  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase
     419571 (KDM1A)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    BRAF-HDAC complex
     419571 (KDM1A)
   Histone demethylases
    419571 (KDM1A)
SSDB
Motif
Pfam: Amino_oxidase SWIRM NAD_binding_8 DAO Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_2 HI0933_like FAD_binding_3 Thi4 Pyr_redox_3 FAD_oxidored 2-Hacid_dh_C GIDA Lycopene_cycl MCRA IlvN
Other DBs
NCBI-GeneID: 419571
NCBI-ProteinID: XP_015153073
CGNC: 547
Ensembl: ENSGALG00000033469
UniProt: A0A1D5P6W8
Position
23
AA seq 826 aa
MLAGGKKAAEAAGGEGGPEAPVPPSAAVGTLGSSAESGGAAERTPRKKEPPRASPPGGAS
EPPAAPATGGETTGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAE
KEKKLPPPPPPAPAEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQT
QKVFLYIRNRTLQLWLDNPKIQLTFEATIQQLEAPYNSDTVLVHRVHSYLERHGLINFGI
YKRVKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTVLEARDRVGGRVATFRKGNYV
ADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLL
EATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKDLLN
KMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEE
KLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLT
VRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLP
LGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTA
SRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKET
VVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPAIPGAPQPIPRLFFAGEHTIRN
YPATVHGALLSGLREAGRIADQFLGAMYTLPRQPTPGVPTQQATSI
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgctggccggggggaagaaggccgcggaggcggcgggcggcgagggcgggcccgaggcc
ccggtgcctccgtccgctgccgtgggaacgctgggttcctccgctgagagcggcggggcc
gcggagcgcactcctcgtaagaaggagccgccccgggcctcgcccccgggaggtgcgtcc
gagccgcccgccgcccccgcgaccggcggcgaaactaccggcatcgcagagacccccgag
ggccgccggaccagccgccgcaagcgggccaaggtggagtatagagagatggatgagagc
cttgcaaatctctcagaggatgagtattactctgaagaagagagaaacgctaaagctgag
aaagagaagaagctgccacctccacctccacccgctcctgcagaagaagagaatgaaagt
gagcctgaggagccctctggtgtggagggtgcagctttccagagtagacttccacatgac
cgtatgacatctcaagaagctgcctgcttccctgatataatcagtgggccacagcagact
cagaaggtgtttctgtacatcaggaaccgcaccctgcagctctggttggataacccaaag
attcagttgacgtttgaggcaactatccaacaactagaagcaccttacaatagtgatacg
gtgctcgttcacagagtacacagctatctggagcggcatggactgattaactttggtatc
tacaagagagtgaagcctcttccaactaagaagactgggaaggtgatcatcattggttct
ggtgtgtctgggttggcagcagctcgccagttgcagagttttgggatggatgtcacagtt
ctggaagccagggaccgagtgggaggaagagttgctacctttcgcaaagggaactacgtg
gctgatctgggagcgatggtggtaacaggacttggaggaaatcccatggctgtggtcagt
aaacaagtgaacatggagttggctaagatcaaacagaagtgcccactgtacgaagcaaac
ggacaagctgttccaaaggagaaagatgaaatggtggagcaagaattcaatcgtctgttg
gaagccacctcttatctcagtcatcagttggattttaatgttctcaataataagcctgtc
tccctaggtcaagctctggaggttgtcatacaattgcaggagaaacacgtgaaggatgag
cagattgaacactggaaaaaaattgtgaaaacacaggaggaattgaaagatcttcttaac
aagatggtgaatttgaaagagaagattaaagaactccatcagcagtataaggaagcatca
gaagtgaagccacctcgggatattacagcagagttccttgtaaagagtaaacacagagat
ctgactgcactttgcaaggagtacgatgaattggcagaaacacaaggaaagctggaagag
aagctgcaggaacttgaagccaatccaccaagtgatgtttatctgtcttcaagggatagg
caaatacttgactggcattttgcaaacctggaatttgctaatgctacacctctctctacg
ctttcactgaagcactgggaccaggacgatgactttgaattcacaggcagccacctgact
gtgaggaatgggtattcctgcgtgcctgtggccttggcagaggggttggatataaagctg
aacacagcagttcggcaggttcgctatacagcttcaggctgtgaagtgattgctgtaaac
actcgttctaccagccagacgttcatttataaatgtgatgctgtgctgtgtacccttccc
ttgggagtcctgaagcagcagcctccagcagtacagtttgtgccacctctccctgagtgg
aaaacttcagcagtgcagcgtatgggattcggcaaccttaacaaggttgtgttgtgtttc
gatcgtgtcttctgggatccaagtgtcaatttgtttggtcacgttggtagcactactgca
agcagaggggagcttttcttgttttggaacctgtacaaagcacccatcttgctggccttg
gtagcaggagaagcagcaggaatcatggagaatatcagtgatgatgtcattgttggacga
tgtctcgccatcctcaaaggcatatttggtagcagtgctgtgccacagcccaaagagact
gtggtctcccgttggcgtgctgatccgtgggcccggggctcatactcctatgtagcagct
ggatcttctggaaatgactatgacttgatggctcaaccaattactccagggccagccatt
ccaggtgctccacagcccattcctcgcctgttttttgcaggagagcacacaattcgcaac
taccctgccactgtacatggtgctttactgagtggactgagagaagcagggcgcatcgca
gaccaatttcttggggccatgtatactttgccccgccagcctacacctggggtgcccaca
caacaagctaccagcatctaa

DBGET integrated database retrieval system