KEGG   Gallus gallus (chicken): 419613Help
Entry
419613            CDS       T01006                                 

Gene name
RSPO1
Definition
(RefSeq) R-spondin-1 precursor
  KO
K19471  R-spondin-1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    419613 (RSPO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Furin-like_2 TSP_1
Motif
Other DBs
NCBI-GeneID: 419613
NCBI-ProteinID: NP_001305373
CGNC: 1375
Ensembl: ENSGALG00000001946
UniProt: E1BVU3
Position
23
AA seq 260 aa AA seqDB search
MQLGLFVVVVFLSSMDLTGGSKVVKGKRQRRISTELSQGCARGCDLCSEFNGCLRCSPKL
FILLERNDIRQIGICLPSCPLGYFGLRNTDMNKCIKCKIENCESCFSRNFCTKCKEGLYL
HKGRCYVTCPEGYSAANGTMECSSPAQCEMSEWGPWGPCSKKRKLCGFKKGNEDRTRRIL
QAPSGDVSLCPATTEVRRCTVQKSQCPEGKRKKKDEQGKQDNTNGNRNRKDTKDAKSGTK
KRKSKQRGAVAPTTSASPAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggactgtttgtggtggtggtttttctaagctcgatggatctaacaggcggc
agcaaagtggtgaagggcaagaggcaaaggcgaattagcactgagctgagccagggctgt
gccaggggctgcgacctgtgctctgagttcaacgggtgcctgagatgttcccccaagctc
ttcatccttctggagaggaacgatatccggcaaattgggatctgcctcccatcctgtcca
ctgggatactttggccttcgcaatacagacatgaacaagtgcatcaaatgcaaaatcgag
aactgtgagtcctgcttcagccgaaacttttgcacaaaatgtaaggaaggtttgtatttg
cacaaagggagatgttacgtcacgtgccccgaaggctactctgctgccaacggcaccatg
gagtgcagcagtcctgcgcaatgtgaaatgagtgagtgggggccctgggggccctgctcc
aagaagaggaagctgtgtggcttcaagaaggggaacgaggaccgaacgcggcggatcctg
caggctccctctggggacgtgtccctgtgccccgccaccacggaggtgcgcagatgcact
gtgcagaagagccaatgccccgaagggaaaaggaagaaaaaggacgagcaaggaaagcaa
gataatacaaacgggaacagaaatcggaaagacaccaaagatgcaaagtctggcaccaag
aagaggaagagcaaacagaggggggctgtggcccccaccacatccgccagccctgcccaa
tag

DBGET integrated database retrieval system