KEGG   Gallus gallus (chicken): 419616
Entry
419616            CDS       T01006                                 

Gene name
SNIP1
Definition
(RefSeq) smad nuclear-interacting protein 1
  KO
K13108  smad nuclear-interacting protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    419616 (SNIP1)
Spliceosome [BR:gga03041]
 Complex B
  Other components
   RES complex
    419616 (SNIP1)
 Complex C
    419616 (SNIP1)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 419616
NCBI-ProteinID: XP_015153272
CGNC: 1427
Ensembl: ENSGALG00000002010
Position
23
AA seq 368 aa
MEAAAERRRERRRWEVAVKAEKRSPRRSGSRSARGSQSPPAEERRGSRGRSSRSPKRKSK
SGRRSKSPRGRRSRSPHHGAVRVKQERDDHPRRGNEERKQRHTSEQEHRRDRSGDRDRHR
DHSDRRKNPSERPGGRGHERERDVQNIREQQAEREFYNERRREHRQNNEGSGVDQNPEHR
QSDNKPKDKAVNKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDE
FLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEHTRADGTVGRRVKPYI
IDLGSGNGTFLNNQRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDKSEANAKDDDEEE
EKEEESDS
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggaggccgcagccgagcggcggcgggagcggcggcggtgggaggtggcggtgaaggcc
gagaagcggagcccgcggcgttccggctcccgttcggcgcgtggcagccaatcaccgccg
gccgaggagcggcggggcagccgcggcaggagcagcagatcgcccaaaaggaagagcaaa
tccggccggaggagcaaatctccgcgcggcaggcggagccggagcccgcaccacggcgct
gtgagggtaaagcaggaacgagatgaccatcctcgtagaggaaatgaggagcgaaagcag
agacacacatcagagcaagaacacaggcgagacagaagcggcgacagagacaggcacaga
gatcactcagacaggagaaaaaatccaagtgaaaggcctggaggtcgaggccatgagcga
gagagagatgttcagaacatccgtgagcagcaagcagagagggagttttataatgagaga
agacgagagcatcgacagaataacgaggggagcggtgttgaccagaatcctgaacacagg
caatctgataataaaccaaaagataaagctgtgaacaaagaaaaaccgagctttgaactg
tctggtgccctcctggaggataccaacactttccgaggcgttgtgatcaagtacagtgag
cccccagaagctcggatcccaaagaaacgatggcgcctctatcctttcaaaaacgatgag
ttcctgccagtcatgtacattcacaggcagagtgcatatctcctgggcagacaccgcagg
atagcagatattcccatcgaccatccctcctgctcaaagcagcacgctgtgtttcagtac
cggcttgtggagcacacccgtgccgatggcacagttggccgcagagtaaagccgtatata
attgatcttggctctggcaatggtacttttctaaacaaccagcggatcgagcctcagcgt
tactatgaactgaaagaaaaggatgtactgaaatttggattcagcagcagggagtatgtt
cttctccacgagtcttcagataaatctgaggccaacgcaaaggacgatgacgaggaggag
gagaaggaggaagagtctgacagttaa

DBGET integrated database retrieval system