KEGG   Gallus gallus (chicken): 419642
Entry
419642            CDS       T01006                                 

Gene name
NFYC
Definition
(RefSeq) nuclear transcription factor Y subunit gamma isoform X3
  KO
K08066  nuclear transcription factor Y, gamma
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419642 (NFYC)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    419642 (NFYC)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X
Other DBs
NCBI-GeneID: 419642
NCBI-ProteinID: XP_004947854
CGNC: 2316
Ensembl: ENSGALG00000003189
UniProt: A0A1D5NXD4
Position
23
AA seq 328 aa
MSTDGSFGTGSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQAVTPAEPVQYYFTLAQQPAAVQVQGQQQGQQTTTSTTTIQPGQIII
AQPQQGQVGEGQQVQIVQAQPQGQSQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQ
LQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMP
AGQDITQPMFIQSTNQSSDGQATQVTGD
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtctacagatggcagcttcggcacaggcagcagcagtgatgcccagcagagcctgcag
tccttctggccccgcgtcatggaggagatccgcaacctcacggtgaaagacttcagggtt
caggagctgcccctggctcggattaagaagataatgaaactagatgaagatgtgaagatg
attagtgctgaggctcctgtgttgttcgccaaggcagctcagatattcataacagaactg
actttgcgagcctggatccacacagaagacaacaagcgcaggactctgcagaggaatgac
attgccatggcaattacaaagtttgatcagtttgactttcttattgatatcgtcccaaga
gatgaactgaagcctccgaagcgtcaggaagaggtgcgtcaggctgtgaccccggctgaa
cccgtgcagtattatttcacacttgctcagcagcctgctgcagtgcaggtccaggggcag
cagcaaggacagcagaccacaacatctacaaccaccatccagccagggcagatcatcatc
gcacagccgcagcaggggcaggtgggagaaggccagcaggtgcagattgtgcaggcccag
ccacaaggacagagccagcaggcgcagagtgggaccgggcagaccatgcaagtcatgcag
cagatcatcaccaacacgggggagatccagcagatcccggttcagttgaatgctggccag
ctgcagtatatccgcttagcccaacctgtgtcaggcacccaggtagtccaggggcagatc
cagacgcttgcaaccaatgcacagcagataacgcagacagaagtccagcaaggacagcag
cagttcagccagttcacagacggacagcagctctaccagatccagcaagtgactatgcct
gcaggccaggacatcacgcagcccatgttcatccagtccaccaaccagagctcagatggc
caagccacgcaggtgacaggggattga

DBGET integrated database retrieval system