KEGG   Gallus gallus (chicken): 419658
Entry
419658            CDS       T01006                                 

Gene name
BSDC1
Definition
(RefSeq) BSD domain-containing protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: BSD LELP1
Other DBs
NCBI-GeneID: 419658
NCBI-ProteinID: NP_001012860
CGNC: 2480
Ensembl: ENSGALG00000003405
UniProt: Q5ZIK6
Position
23
AA seq 451 aa
MAEGEDAGWWRSWLQQSYQAVKEKSTEALEFMKRDLAEFTQVVQHDTACTIAATASVVKD
RLARTEASGATEKVRKGISDFLGVISDTFAPSPDKTIDCDVITLMATPTGTTEPYDSAKA
RLYSLQSDPATYCNEPDGPAELLEAWLSRFSLEEKKGEIAELLATSPSIRALYTKMVPAA
VSHSEFWQRYFYKVHRLEQDEVRREALKQRAEQSIHQEEPGWEEDEEEFLGMSPLPCANV
KFPQAAEKASVSAALEGSQPSVHKGPSGESWAILPPELAPAEGSPSESSESVSLVTQIAN
PASVPVVQLQTGVQPSGNRDLSQRLLEATSEEQSPLPKPPEPGHPSAAAQEPAVCSEQTA
VTGPKEVESKAQGRTETLKEEGPTDLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDF
DLDMTEEEVQLALSKVEVSGELEDEEWEDWE
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcggaaggggaggacgcgggctggtggcggagctggctgcaacagagctaccaggcc
gtcaaggagaagtccacagaagctttagaattcatgaagcgggacctggctgagttcact
caagttgtgcagcatgacacagcctgcacgattgctgctacggccagcgtggtgaaggac
agactggcaaggacagaagcttctggtgcgactgaaaaggtgaggaaggggatctctgac
ttcctgggtgtcatctcagacacttttgctccctcgccagacaagaccattgactgcgat
gtcataacgttgatggcaacacccacaggtaccacagagccctatgacagcgcgaaggct
cgcctctacagcctccagtcagacccagccacctactgcaacgaacctgacggccctgct
gagctccttgaagcctggctctcccggtttagcctggaagagaagaaaggggagatcgca
gaactgctggcaaccagcccttccatccgggctctctacaccaaaatggtccctgcagct
gtctcccattcggagttctggcaacgctacttctataaagtgcatcgcctggagcaggat
gaagtccggagggaggctctgaagcagcgcgcagagcagagcattcaccaagaggagcca
ggctgggaagaggatgaagaggagttcttggggatgtcacccctgccttgtgcaaacgtg
aaatttccacaagcagcagagaaagcatctgtttctgcagccctggagggaagccagccc
tctgttcacaagggaccctcgggggaaagctgggccatcctccctcctgagctggcccca
gcggaggggagcccctctgagagcagtgagagcgtctcccttgtgactcagattgcaaac
cctgcctctgtgcctgttgtgcagctacagactggagtgcagccgtctgggaacagagac
ctctcccagaggctgctggaggccacctcagaggagcagagcccgctgccaaagcctcct
gaaccggggcatccctctgcagctgcccaggagccagcagtgtgctcagagcaaacagct
gtgactgggcccaaagaggtggagagcaaagcccaaggcaggacagagactctgaaagag
gaaggaccaacagatctgcgtgtctttgagctgaactctgacagtggaaagtccacccct
tccaacaacggcaagaaaggttccagcactgatatcagcgaggactgggaaaaggacttt
gatttggatatgactgaagaggaggtgcagctggcgctgtcgaaggtggaggtgtctggg
gagctggaagatgaagagtgggaagactgggaataa

DBGET integrated database retrieval system