KEGG   Gallus gallus (chicken): 419680
Entry
419680            CDS       T01006                                 
Symbol
CAP1
Name
(RefSeq) adenylyl cyclase-associated protein 1
  KO
K17261  adenylyl cyclase-associated protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    419680 (CAP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    419680 (CAP1)
Membrane trafficking [BR:gga04131]
 Others
  Actin-binding proteins
   Others
    419680 (CAP1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   419680 (CAP1)
SSDB
Motif
Pfam: CAP_C CAP_N TBCC
Other DBs
NCBI-GeneID: 419680
NCBI-ProteinID: XP_003642632
CGNC: 2866
Ensembl: ENSGALG00000036294
Position
23:5697363..5709111
AA seq 537 aa
MGLPSPAPPSLASANRRPPTPEAPPLPSRRAGPCALPVRGAGAGSGGCGGCWAAAAAEGQ
REAEDIAAMERLVERLERAVERLETVCQGPGMCGDGSSPGVAQYVQAFDAILSGPVAEYI
NISKEVGGDVQKHAEMVHAGFMTERSLLVTASQHQQPSENVFSTLLKPISEQIQMVQNLR
EKNRGSKQFNHLSAVSESIPALGWVAMSPKPGPYVKEMTDAAMFYTNRILKEYKDVDKKQ
VDWVKAYLRIWTELQAYIKEYHTTGLTWSKTGPVATEGAKAPSTAPTGAAPPPPGPPPPP
APSHPSSGADDSATRSALFAQINRGEGITSGLRHVSDDMKTHKNPALKNQGGPIRSGPKP
FTSPKPACSVNPSQKTSPKQPALLELEGKKWRVENQENATNLVISDTELKQVAYVFKCTN
STLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDIKVQVMGKVPTISINKTDGCHV
YLSKNSLDCEIVSAKSSEMNVLIPTEGGDFTEFPVPEQFKTVWNGQKLVTTVTEIAG
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggggctcccctcccctgcccccccctctctcgcatccgccaatcgcaggccgccgacg
cccgaggctcctcccctcccctcgcgccgcgccgggccgtgcgcacttccggtgcgcggg
gcgggggccggaagcggcgggtgcggggggtgctgggcggcggcggcggcggaggggcag
cgggaggctgaggacatcgcagctatggagcggctggtggaacggctggagagggctgtg
gagcgcctggagacggtgtgccaagggcctggcatgtgtggagatggctcttccccggga
gtggctcagtacgtgcaggcttttgatgctattctgtctggcccggtagctgagtacatc
aacatcagcaaagaagttggcggggacgtgcagaagcatgctgagatggttcatgcaggt
ttcatgactgagaggtctcttctggtgacagcatctcaacatcagcagccatcagagaat
gtgttttcgacacttctgaaaccgatttcggagcaaatccagatggtgcagaatttaagg
gagaagaaccgcggcagcaaacagttcaatcacttatcagcagtcagtgagagcatcccg
gccctgggctgggtggccatgtctccaaaacctggtccttatgtaaaggaaatgactgat
gctgccatgttttataccaaccgtatccttaaggagtacaaagatgtagataaaaagcaa
gtggactgggtaaaggcttacctgcgtatctggacggagctgcaggcctatatcaaagag
tatcacaccacagggctgacttggagcaaaacgggtcccgtggcaacagaaggggccaaa
gcaccatccacagcccccactggagcggcaccgcctccccctggccctcctcctccccct
gctccctcccaccccagctctggtgcagacgactctgccacccgctctgctctcttcgcc
cagatcaatcggggagagggcatcacatcgggcttaagacatgtttcggatgatatgaag
acccacaagaatccagcgctgaagaaccaaggaggtcctataagaagtggacccaagcct
ttcacttctcccaaaccagcctgtagtgttaatccctcccaaaaaacctctccaaagcaa
cctgcattgctagaattagaaggcaaaaagtggagagtggaaaaccaggaaaatgccact
aacctggtaatcagtgacacagaactgaagcaggtagcatatgttttcaagtgcacaaac
agcacactccaaatcaaaggcaagatcaactccatcacccttgataactgtaagaagcta
ggtctggtgtttgatgatgtggtgggcatcgtagagataataaatagcagggacatcaaa
gttcaggtaatgggtaaagtgccaacgatctccatcaacaaaacagacggttgccacgtg
tatctgagcaagaactccctagactgcgaaatcgtcagtgccaagtcatcagagatgaat
gtccttattcccaccgagggtggtgactttactgaattccctgtcccagaacagttcaag
acagtgtggaacggtcagaagctggttaccactgtgacggaaattgctggctaa

DBGET integrated database retrieval system