KEGG   Gallus gallus (chicken): 419681
Entry
419681            CDS       T01006                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1 precursor
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00062  Fatty acid elongation
gga01100  Metabolic pathways
gga01212  Fatty acid metabolism
gga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    419681 (PPT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    419681 (PPT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gga01004]
    419681 (PPT1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     419681 (PPT1)
Lipid biosynthesis proteins [BR:gga01004]
 Fatty acid synthase
  Component type
   419681 (PPT1)
SSDB
Motif
Pfam: Palm_thioest AlkA_N
Other DBs
NCBI-GeneID: 419681
NCBI-ProteinID: NP_001026074
CGNC: 2887
Ensembl: ENSGALG00000003936
UniProt: Q5ZJT3
Position
23
AA seq 302 aa
MAALGLAVPALLWLGLGLGLGSGRAMAAVPLVIWHGMGDSCCNPLSMGYVRDLVQRRIPG
IYVLSLRIGSSLVQDVENSFFMNVNDQVREVCSQLAKDPHLKGGYNAMGFSQGGQFLRAV
AQRCPSPPMFTLISIGGQHQGVYGFPRCPGESSQICDWIRKMLDLGAYTQAVQEHLVQAQ
YWHDPLKEEDYRKKSIFLADINQERGINETYKKNLMALKKFVMVKFLNDTMVDPPISEWF
GFYKSGQAKDTIPLKETLLYKEDRLGLQQMDKAGKLVFLGVEGDHLHFTEEWFYTHILPF
LQ
NT seq 909 nt   +upstreamnt  +downstreamnt
atggcggcgctcgggctggcggtgccggcgctgctgtggctgggtctgggtctgggtctg
ggttcgggccgcgctatggccgccgttccactggtcatctggcacggcatgggagacagc
tgctgcaatccgctgagtatgggctacgtccgggacttggtgcagcgcagaatcccgggc
atctacgtgctgtccctgcgcatcggcagctccctggtgcaggatgtggagaacagcttc
ttcatgaatgttaatgaccaagtgagagaggtgtgcagccaactcgcaaaggacccccac
ctgaaaggaggctacaacgcaatgggcttctcccaaggaggccagttcctgagggccgtg
gcccagagatgcccttctcctcccatgttcactttgatctccattggggggcagcaccaa
ggagtgtatggctttccacgctgtcctggtgagagctcccaaatctgtgactggatccga
aagatgctggatctgggtgcctacacacaagctgttcaagagcacttggtacaagcacag
tattggcatgatcctttgaaggaggaggactacagaaaaaagagcatctttttggctgac
ataaatcaggagaggggcatcaatgagacatacaagaaaaacctgatggctttgaaaaag
ttcgtgatggtgaaatttctcaatgatactatggttgatcctccgatctctgagtggttt
gggttttacaaaagcggccaagccaaggacaccattcctttgaaggagaccttgctgtac
aaagaggatcgcctggggctgcagcagatggacaaagcaggaaagctggtgttcctgggg
gtggaaggggatcacctgcacttcacagaagagtggttttatacccatatcctcccattc
ctccagtga

DBGET integrated database retrieval system