KEGG   Gallus gallus (chicken): 419701Help
Entry
419701            CDS       T01006                                 

Gene name
HMBS
Definition
(RefSeq) porphobilinogen deaminase isoform X5
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00860  Porphyrin and chlorophyll metabolism
gga01100  Metabolic pathways
Module
gga_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    419701 (HMBS)
Enzymes [BR:gga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     419701 (HMBS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porphobil_deam Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 419701
NCBI-ProteinID: XP_004947973
CGNC: 168
Ensembl: ENSGALG00000042939
Position
24
AA seq 300 aa AA seqDB search
MHLKGMSLWHYVTQPAVQCCDCCSLIHRVDLVVHSLKDLPTSLPPGFTIGAICKRENPLD
AVVFHPKNCGKTLSVLPEKSVIGTSSLRRAAQLKKKFPQLEFRDIRGNLNTRLKKLDEKE
DFSAIILAAAGLKRMGWENRIGQLLSPEDCLYAVGQGALAVEVRAKDQETLNMVSALQDG
ETVLCCIAERAFMKRLEGGCSVPVAVNTMLKDGQLYLTGAVYSLDGSDSLKETMQTSVNY
PHRNEDGPNDDVQHVGITAKNVPGQAQEAAENLGIELASLLLSKGAKHILSVARQLNDAC
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgaaaggaatgagtctctggcactatgtgacccaaccagctgttcagtgttgt
gactgctgttctctaattcatagagttgacctggtagttcactccttgaaggacctgcca
acttctcttcctcctggctttaccattggtgctatttgcaaaagagagaacccacttgat
gctgttgtctttcaccccaaaaactgtgggaaaacgctcagtgttcttcctgaaaagagt
gttatcggaactagttcacttcggcgagcggcccagctcaaaaagaagttccctcagcta
gaattcagggatattagaggaaatttaaacacccgcttgaagaagctggatgagaaggaa
gacttcagtgctataatcctagctgctgctggactgaagagaatgggctgggagaatcgc
ataggtcagctcctgagccctgaagattgtctgtatgctgtgggacagggggctttagca
gtggaggttcgtgccaaagaccaagaaacactgaatatggtatctgccctgcaggatggg
gaaactgtattatgctgcattgctgagagagctttcatgaaacgtttggagggtggctgt
agtgtccctgttgcagttaacaccatgctgaaagatggccagttgtacttgacaggtgca
gtctacagtttggatggatccgatagcctgaaggaaacaatgcagaccagcgttaattat
ccacaccggaatgaagatggaccaaatgatgatgtgcagcatgttggcatcacagccaag
aacgtccctggtcaggcgcaggaggctgcagagaaccttggtattgaactagctagttta
cttctgagcaagggagctaagcacatccttagtgtggcaaggcagctgaacgatgcctgc
taa

DBGET integrated database retrieval system