KEGG   Gallus gallus (chicken): 419710
Entry
419710            CDS       T01006                                 

Gene name
CDON
Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
gga  Gallus gallus (chicken)
Pathway
gga04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    419710 (CDON)
SSDB
Motif
Pfam: Ig_3 fn3 I-set Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Ig_5 Ig_6 BiPBP_C EphA2_TM Interfer-bind
Other DBs
NCBI-GeneID: 419710
NCBI-ProteinID: XP_015153589
CGNC: 51066
Ensembl: ENSGALG00000035419
UniProt: A0A1D5NW33
Position
24
AA seq 1117 aa
MQSAPACLHALLAAAALLSASSSDLTPRFTSEPISAVQKPGGPVVLRCSAEPPAAHISWL
LDGEPLGSGLPGVEIQHGSLSIASLSLETSGRYQCVANSSAGAVLSRAAVVSMGSLAHFG
PSLTPIVVAEEGGTALIGCAVPQSNPRAQIRFRVRGKWLQQPADKYLILPSGNLQIFNVS
MEDRGSYRCAAYNPVTHDLRIEPTGRKLVITRSSTAQPRILHPRQPQALSVPQRSPLTLE
CVAAGLPAAAVRWERDGRDALRGGRWALQHSHLVTEGLQPEDSGNYSCVVGEEAYINYSL
TVLEPASISKGLQDETVAVGTTVLLQCTAHGIPPPALSWLHNAAPLHSSPRHFLLGSSLQ
IRGVTMQDSGVYQCIADNGVGFAQSAGRLRVQPEADPKAEEMALTETAQSDESRSDSGVG
AAFPSSPPAKLHLDTAATDKPWGSISPPEAPIILSPPQTLSPDVYTLLWRSGRDGGLPIN
AYFVKYRKLDDGVGAAGSWHTVRVPGSENELRLSELEPSSLYEVLMVARSAAGEGQPAML
TFRTSKERTSSSKNTQAPSPPVGIPKHPVVHEGTNSFGVVLPDASRHSGVPEAPDRPTIS
TASESSVYVTWIPRANGGSPITAFKVEYRRLGRSSDWLVAADSISPSKLSVEVRSLEPGE
LYKFRVIAVNNYGESPRSAASRPYQVAGFTQRFSSRPIAGPHIAYTEAISDTQIMLKWTY
ITSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGTKQWHLINHLQPETSYDIKMQCYNE
GGESEYSNVMICETKVKRMPGASEYPAKELSTPPSPPERAGGSGGPSSGPVRSSDMLYLI
VGCVLGVMVLILIVFIAMCLWKNRQQNAMHKYDPPGYLYQGAEINGQMIKYTTLPGTSRV
NGSVHGSFISSSTGSGCPHHHKAAGGLDGATNGGVGLHSSSLPGAHLDCERAHRMVNGGG
LHAALPQAEPPECISCRNCRNNNRCFTKTNGTFSSSALPVLPIVAPYQQDSLEMKPLSHI
MVAMCLASGVPEHGGRMEEDSTEMAEQPPSPQPCCRGSAGPLCLEYTDGDGCALSETPNH
VLSWSPLVLQPVPKDCRDKAGWTATLRGSGQLPVQES
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgcagtcggcccctgcctgcctgcatgcactgcttgctgccgccgcgctcctctccgcc
agcagctcagacttgactccccgctttacttccgagcccatctctgccgtccagaagccc
ggtggccccgtggtgctgcgctgctccgcagagcccccggcagcacacatctcctggctg
ctggatggagagccgctgggcagcgggctgccaggggtggaaatccagcacggctctctg
agcatcgcctccctgagcctggagacgtccggccgctatcagtgcgtggccaacagcagc
gcgggcgcagttctgagcagggctgcggtggtgtcaatgggcagtttggctcactttggc
ccatcgctgacccccatcgttgtggcagaggaaggaggaacggcgctcatcggctgcgcg
gtgccgcagagcaaccccagagctcagattcgattccgggtgcgggggaagtggctgcag
cagcctgcagataagtacctcattctcccgtcgggaaacctgcagatcttcaatgtgtcc
atggaggacagggggtcctacaggtgtgctgcctacaaccccgtcactcacgacctcaga
atagaacccaccgggaggaaactcgtcatcacacgctcctccaccgcacagccccgcatt
ctgcacccccggcagccgcaggcgctgtccgtgccgcagcgcagcccgctgaccctggag
tgcgtggctgcagggctgcctgcggccgccgtgcgctgggagagggacggccgggatgcg
ctgcggggggggcgctgggcactgcagcactcccacctggtgacggaggggctgcagccg
gaggactccgggaactactcgtgcgtggtgggggaggaggcctacatcaattactcgctc
acagtgctcgaacctgcctcaatttccaaaggactgcaagatgagaccgtggccgtgggc
acaacggtgttactgcagtgcacagcccacgggatcccccctccagcgctcagctggctg
cacaacgctgcacccctccattcatccccgcggcacttcctgctggggagcagcctgcag
atccgtggtgtcaccatgcaggactccggggtgtaccaatgcattgcggataacggcgtt
ggcttcgcacagtcagctgggaggctccgtgtgcagccagaagctgacccgaaagcagaa
gaaatggctctcacagagactgcccaaagcgatgagagccgcagcgattccggtgtggga
gcggcatttcccagctcacctccagcaaagctgcatttggacacggctgcaacagacaaa
ccgtggggcagcatttccccccccgaggcgcccatcatcctcagccccccgcagacgctc
agcccagatgtgtacacgttgctgtggcgctcggggcgggacggcggtttgcccatcaac
gcgtactttgtgaagtaccgcaagctggatgacggtgtgggcgcagctggcagctggcac
acagtgcgcgtcccgggcagcgagaacgagctgcggctcagtgagttggagccctccagc
ctctacgaagtgctgatggtggccaggagcgctgccggcgaaggccagcctgccatgctg
accttccgtaccagcaaagaaagaacgtcgtcctcaaagaacacacaggctccgtctcca
ccggtgggcatcccgaagcaccccgttgtccatgaaggcaccaacagtttcggagtggtg
ctccccgatgcgtctcggcacagcggagttccagaagctcccgaccgccccaccatctcc
accgcgtccgaatcctccgtctacgtcacgtggataccccgagcaaacgggggctccccc
atcaccgccttcaaagtggagtacaggcggctgggccgcagcagcgactggctggtggca
gccgacagcatttctccttccaagctgtccgtggaggtccgcagtttggagccaggagag
ctgtacaagttccgtgtgatcgctgtgaacaactatggggagagcccccgcagcgccgcg
tcgcgcccctaccaggtcgcaggcttcacccagcgcttctccagccgccccatcgccggg
ccccacattgcttacactgaagccatcagtgacactcagatcatgttgaagtggacgtac
attacgtcaagcaacaacaacacccccatccaaggcttctacatctattatcggcccacc
gacagcgacaacgacagcgactacaagagggatgttgtggaaggcacaaagcagtggcac
ctgataaatcacctgcagccagaaacctcatacgacataaaaatgcagtgctataacgaa
ggtggtgaaagcgagtacagcaacgtgatgatctgcgagacgaaggtgaagcgcatgcca
ggagcatctgaataccctgcgaaggagctcagcacccctcccagcccccccgagcgggca
gggggcagcgggggcccctcgtccggcccggtgcgcagcagcgacatgctgtacctgatc
gtgggctgcgtcctgggcgtgatggtcctcatcctgatcgttttcatcgccatgtgtctg
tggaagaaccgccagcagaacgccatgcacaagtacgaccctcccggctatttgtaccaa
ggggcagagatcaacgggcagatgatcaaatacaccaccctgcccggcacgagccgcgtc
aacggcagcgtccacggcagcttcatcagcagcagcactggcagcggctgcccgcaccac
cacaaagcggccggggggctcgatggggccaccaacggaggggttgggctgcacagcagc
tccctgcccggcgcacacctggactgtgagcgtgcccaccgcatggtcaacggcgggggg
ctgcatgcagcgctgccacaggcggaaccccctgagtgcatcagctgcaggaactgccgc
aacaacaacaggtgtttcaccaaaaccaacggcactttcagcagcagcgcgctgcccgtc
ctgcccatcgtcgcaccttaccagcaggacagcctggagatgaaacccctgagccacatc
atggtggccatgtgtttggcctccggcgtccccgagcacggtgggcggatggaggaggac
agcacggagatggccgagcagccccccagcccacagccctgctgcaggggcagcgccggg
ccgctctgcctggagtacacagatggtgacggctgtgcgctctcggaaacaccaaaccac
gttctgagctggagcccgctggttctgcagcctgtgcccaaggactgcagggacaaagca
ggctggactgcaacgctgcgtggttccgggcagctcccagtgcaggagagctga

DBGET integrated database retrieval system