KEGG   Gallus gallus (chicken): 419723
Entry
419723            CDS       T01006                                 

Gene name
FLI1
Definition
(RefSeq) Friend leukemia integration 1 transcription factor
  KO
K09436  friend leukemia integration 1 transcription factor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419723 (FLI1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    419723 (FLI1)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 419723
NCBI-ProteinID: NP_001026079
CGNC: 51069
Ensembl: ENSGALG00000001161
UniProt: Q5ZKX5
Position
24
AA seq 432 aa
MDGTIKEALSVVSDDQSLFDSTYGAATHLPKADMTASGNPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVNKCSKLVGAGTESNPMSYSTYMDEKNGPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYGLMEIDTTLFQNMDGKELCKTNKDDFLRTTS
LYNTEVLLSHLSYLRESSSLLVYNTPSHTEASSRLATKEGPPVAGTQNVNKTTEQQRPQP
DPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNASCITWEGTNGEFKMTDPDEVARR
WGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYK
YPSDLSYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAASPYWTSPAGSIYPNPNVPRHP
NAHVSPHLGSYY
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggacggcactattaaggaggccctgtcggtggtgagcgacgaccagtccctctttgac
tccacgtacggcgctgccactcacctccccaaggcagacatgacagcctcagggaaccct
gattatggccagccacacaaaatcaaccctttgcctcctcagcaggagtggattaatcag
ccagtccgggtcaatgttaaaagagaatatgaccacatgaatggatcaagggagtcccct
gtagactgtagtgtgaacaaatgcagcaagctcgttggagcaggcacagagtccaacccg
atgagttacagcacctacatggatgagaagaatgggcctcctcccaacatgaccaccaat
gagaggagagtcattgtcccagcagatcccaccctatggacccaggaacacgtgcgccag
tggctggaatgggccataaaggagtatggattaatggagattgacaccaccctcttccag
aatatggatggcaaagagctctgcaaaacgaacaaggatgacttcctccgaaccacctcc
ctctacaacacagaagttctgttgtctcacctcagttacctcagggaaagtagctcactg
ctggtctacaatactccatcccacacagaagcttcctcacgtcttgccaccaaagaaggt
cctcctgttgcagggacacaaaacgtgaacaagacaacagaacagcaacggcctcagcca
gatccctatcaaatcctggggcccactagtagtcgtcttgccaatcctgggagtgggcag
atacaactatggcagttcctcctcgagttgctgtcggacagttccaacgccagctgtatc
acatgggaagggaccaatggggaattcaagatgacagacccagatgaagtggcacggcgc
tggggagaacgcaaaagcaagcccaacatgaattatgacaagctgagccgagcccttcga
tactactatgataagaacattatgaccaaagtgcatggcaaaaggtatgcctacaaattt
gactttcatggcattgcccaggctctccagcctcatcccactgaatcatcaatgtacaag
tatccatcagatctctcctacatgccttcttaccatgcccaccagcagaaggtgaacttt
gtacccccacacccttcttctatgcctgtcacatcatccagtttcttcggagcagcctca
ccttattggacctcccctgctggaagcatttatccaaaccccaacgttcctcgccatccc
aacgctcatgtatcaccacacttgggcagctattactag

DBGET integrated database retrieval system