KEGG   Gallus gallus (chicken): 419727
Entry
419727            CDS       T01006                                 

Gene name
APLP2
Definition
(RefSeq) amyloid-like protein 2 precursor
  KO
K08117  amyloid-like protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    419727 (APLP2)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:gga00535]
    419727 (APLP2)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   419727 (APLP2)
Proteoglycans [BR:gga00535]
 Cell surface proteoglycans
  Others
   419727 (APLP2)
SSDB
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid Kunitz_BPTI
Other DBs
NCBI-GeneID: 419727
NCBI-ProteinID: NP_001006317
CGNC: 51073
Ensembl: ENSGALG00000001250
UniProt: F1P0A7
Position
24
AA seq 753 aa
MGTARHFPLLLLLGLAGPAVTLAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTG
KWEPDTSGTKSCFGTKEEILQYCQEMYPDLQITNVVEANQPVSIDSWCKRGKKQCKDHTH
IVVPYKCLVGEFVSDVLLVPEKCRFFHKERMDVCESHQHWHTAAKEACLTEGMILHSYGM
LLPCGVDQFHGTEYVCCPQTKVVDEALSKEEEDEDEDEDYDTYKSEFPTEAGVEDFTGTA
VEEDEDEEDEGEEEEDVVEDRDYYYNSYKVDDYDEETTTEPTSDKAVSEKEVSSDMKSVC
SQEAMTGPCRAVMPRWYFDSNKRKCIRFIYGGCGGNRNNFESEEYCMAVCKKMMPTDDVD
VYFETPADDNEHARFQKAKEQLEVRHHNRMDRVKKEWEEAEHQAVNLPKAERQTLIQHFQ
AMVKSLEKEAASEKQQLVETHLARVEAILNDRRRIALENYLAALQAVPPRPHRIVQALKR
YVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLRVIEERMNQSLSLLYKVPYVAE
EIQDEIDELLQEQRADMDQFTSSISESQVDVRVSSEESEEIHLEGKPFRPFQVKTFPAVP
ENEDPQPDLYHPMKKGSGMTELDRLSDTEEKVINSKKKVDENVVIDETLDVKEMIFNAER
VGGLVDEPDNDNSLRDDFSFSSSALIGLLVIAVAIATVIVISLVMLRKRQYGTISHGIVE
VDPMLTPEERHLSKMQNHGYENPTYKYLEQMQI
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgggaaccgcacggcacttccccctcctgctcctgctggggctggccggccccgccgtc
acgctggccggatacatcgaggcactcgcagccaatgctgggacagggtttgcggtggca
gagcctcaaattgccatgttctgtgggaagctaaatatgcatgtgaatatccagaccggg
aaatgggaacctgacacttctgggaccaagagctgctttggaacgaaggaggagattctg
cagtactgccaggagatgtatccagaccttcagatcacaaatgtcgtggaagccaatcag
cctgtcagtattgacagctggtgcaagagggggaagaagcagtgcaaggaccacactcat
atcgtcgtgccctacaagtgcctggtgggtgagtttgtgagcgacgtgctgctggtcccg
gagaagtgccggttcttccacaaggagcggatggatgtgtgtgaaagccatcagcactgg
cacacggcagcaaaagaggcctgtctgacagaagggatgatcctgcacagttacggcatg
ctgctgccctgcggagtagaccagttccatggaacagaatatgtatgttgtccccagaca
aaagttgtggatgaggctctgtccaaagaggaagaggatgaagatgaggacgaagactat
gacacttacaaaagtgagttccctacagaagcaggtgtagaagacttcacaggaacagct
gtggaggaagatgaggatgaagaagatgaaggggaggaagaagaggatgtggtggaagat
cgtgattactattacaatagctacaaagtagatgattacgatgaggagaccactacagag
cccaccagtgacaaggctgtttctgaaaaggaagtgagcagtgatatgaaatctgtctgc
tcccaggaggcgatgacagggccctgccgggctgtgatgcctcgttggtacttcgactct
aacaagagaaaatgcattcgctttatatatggaggctgcggaggcaacaggaacaatttt
gagtcagaggagtattgtatggctgtgtgtaaaaagatgatgccaactgatgatgtggat
gtgtatttcgaaacccctgctgatgacaatgaacatgcccgcttccagaaggcgaaggag
cagctggaggtcaggcaccacaaccgcatggatcgggtgaaaaaggaatgggaggaggca
gagcaccaagctgtaaatctccccaaggcagaaagacagactctcattcagcacttccag
gcaatggttaaatctctggagaaagaggcagcaagtgagaagcagcagcttgtggaaact
cacctggctcgtgtggaagccatactgaatgatcgccgtcggattgctctggagaactac
ctggctgccctgcaagctgtcccaccacgaccccaccgcattgtgcaagctctgaagcgc
tacgttcgtgctgagaacaaggaccgtctgcacaccatccgccattaccagcatgtcctg
gcagttgacccagaaaaggctgcacagatgaaatctcaggtgatgacacatctccgtgtg
attgaggagcggatgaatcaaagcttatctctgctctacaaggtgccatatgtggctgaa
gaaatccaggatgagattgatgaattgcttcaggagcagcgtgcagacatggatcagttc
acatcgtccatttctgaatcccaggtggatgtcagggtgagctctgaggaaagtgaagaa
attcacctggagggcaaacctttccgtccgttccaggtgaaaacattcccagccgtgcct
gaaaacgaagatcctcagccggatttgtaccatccaatgaaaaaaggttctggcatgact
gagttggataggctgtctgacactgaagaaaaagtgattaacagcaagaagaaagtggat
gaaaatgtggtaattgatgaaaccctcgacgtgaaggaaatgattttcaatgcggagcgc
gtcggtgggctggtggatgagccggataatgacaactcgcttcgtgatgacttcagtttc
agcagcagtgccctcattggtctgttggtgattgctgttgccatagctactgtgatagtc
atcagcttggtgatgctgaggaagaggcagtatggaaccatcagccatggaattgtggag
gttgacccaatgcttacccctgaagaacggcatctgagcaagatgcaaaaccatggctat
gagaaccccacttacaaatacctggagcagatgcagatataa

DBGET integrated database retrieval system