KEGG   Gallus gallus (chicken): 419729
Entry
419729            CDS       T01006                                 

Gene name
PRDM10
Definition
(RefSeq) PR domain zinc finger protein 10 isoform X4
  KO
K24643  PR domain zinc finger protein 10 [EC:2.1.1.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419729 (PRDM10)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     419729 (PRDM10)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    419729 (PRDM10)
SSDB
Motif
Pfam: Tristanin_u2 zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_2 zf_PR_Knuckle zf-met zf-C2H2_6 zf-BED zf-Di19 DUF629 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 419729
NCBI-ProteinID: XP_003642634
CGNC: 872
Position
24
AA seq 1163 aa
MEHHGREEMDSKEESPQVWPDSAEQDQNAAQVHFVPEAGTVAQIVYSEEQERPSQQVVYT
ADGTSYTSVDTSEHTLVYIHPVEATQTLFTDPSQVAYVQQDATTQQASLPVHNQVLPPME
AVDGSDPLAPLQNQMERMETKEEDDEDEEDDEDGEDTDMDEWDPDPPRPFDPNDLWCEEC
NNAHPSVCPKHGPLHPIPNRPVLTKARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEG
PLVRQTELKDCYIHLKVSLDKGDRKERDLQEDLWFELSSEALCNWMMFVRPAQNHLEQNL
VAYQYGHHIYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCY
ECNRRFMSSEQLQQHLNSHDEKLDFFSRARGRGRGRGKRRFGPGRRPGRPPKFMRMEVTI
ENGEKCEEGTQDLLHFSSKGQFDEARQATLNGLEQQEQTPVPSETQSTLEQQSENHPLQI
QPQHDESVVPTQSTMTADDMRRAKRIRNAALQHLFIRKSFRPFKCLQCGKAFREKDKLDQ
HLRFHGREGNCPLTCDICNKGFINSGSLESHMKFHMDQKTYSCIFCPESFDRLDLLKDHV
AIHIIDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLRLHMLRHS
DRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRIASTDYESFMF
KCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKVYKSASKR
KAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYSSKT
KMVQHIRKKHPEFAQLPNTIHAPLATAVISSTPAVLTTDSTTGETVVTTDLLTQAMTELS
QTLTTDYRTPQGDYQRIQYIPVSQSTTGLQQPQHIQLQVVQVAQATSPHQSQHSTVDVGQ
LHDPQTYTQHAIQVQHIQVTEPSPTAQSSSQVGGQPLSPSSQQSQQELSPSQMQTAASTQ
SQALQQQQGSSVQHTYLPSTWNSFQSYSSEIQMMTIPQGQYVITETAVGTPVTTVNTGQV
KAVTQTHYVISEGQPDLDVKQNSSLSSEVQVGVSQPPTHTDTLESQTSNQQQTTQYIITT
TTNGNGGSEVHITKPRTFSAEHE
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggagcaccacggcagggaggagatggactcgaaagaagaaagtcctcaggtgtggccg
gactctgctgagcaggaccagaatgctgctcaggtgcacttcgtcccagaagcagggacg
gtggcacagattgtgtacagcgaggagcaggaacgtccctcccagcaggtggtgtacaca
gcggatggcacctcgtacacctcggtggacacctcagagcacacgctggtttacatccat
cccgtggaagctacacagactctgtttacagatccgtcccaagtggcttatgtccagcag
gatgccaccacacagcaggcatcattaccggtgcataaccaggtgttacctcctatggag
gcagtggatggttctgaccctttagcaccgctgcagaatcagatggaaaggatggaaaca
aaagaggaagacgacgaggatgaagaagatgatgaagatggggaagacactgacatggat
gaatgggatccagatccacctcgaccatttgatcccaatgatctgtggtgtgaagagtgt
aataatgcgcatccctccgtgtgtccaaaacatggacctttgcatccaatcccaaaccgg
cctgtgctgaccaaggcaagagccagccttcccttggtgctctacatagacaggtttttg
ggaggtgtcttctccaaaaggcgtatccccaaacgcacacagtttggacctgtagaagga
cccctggttagacaaactgagctcaaagactgctatatccatttgaaggtgtctcttgat
aagggtgacagaaaagagagagatttgcaagaggacctgtggtttgaactttctagcgag
gctctttgtaactggatgatgtttgtgcgtccagctcaaaaccatttggagcagaacctg
gttgcgtatcagtatggccaccacatttattacacaaccattaaaaatgtggagcccaaa
caggaactcaaggtgtggtatgctgcgtcttatgcggagtttgtgaaccagaagatccat
gacatatctgaggaggaacggaaggttctcagagagcaagagaagaactggccgtgttat
gagtgcaaccgtcgtttcatgagctcagagcaactccagcagcacctcaactcccatgat
gagaagctggacttcttcagcagagccagaggcagaggtcgtggacgaggaaaaagaagg
tttggacctggcaggcgcccggggcgccctcccaaattcatgcgtatggaagtaaccatt
gaaaatggagaaaagtgtgaagaagggacacaggacttgctgcatttttccagcaagggg
cagtttgatgaggccagacaagcaacactgaatgggctggagcagcaggaacagactcca
gtgccgtcagagacacagtcgacactggaacagcagtcagaaaaccacccgctacaaatc
cagccccagcatgatgagagcgtggtgcccacgcagagcaccatgacagcagatgacatg
aggcgagcaaagcgtatcaggaatgcagctcttcagcacctgttcataaggaaatccttc
cgcccattcaaatgcctgcagtgtgggaaggcgttccgggaaaaggacaaactggatcag
catctgcgcttccatggccgggaagggaactgccctttgacttgtgacatttgcaacaag
ggctttatcaacagcgggtctctcgagagccacatgaagttccacatggaccagaaaacg
tactcctgcattttctgtcctgagtccttcgaccgcttggacttactcaaagatcacgtg
gccatccatatcattgatggctatttcacctgtcctacctgcaaaaagcgctttccagac
tttatccaggtcaagaaacacgtacgcagtttccattcagagaagatttatcagtgcaca
gagtgtgacaaggctttctgccgccctgacaagctgcggctccacatgttgcgacactcg
gaccgcaaagacttcctgtgctccacgtgtggcaagcagttcaagaggaaagacaaattg
cgagagcacatgcagaggatgcacaacccagagagggaggccaagaaagctgaccgaatc
agccgctcaaaaactttcaagcctcggatagcttccactgactatgaaagcttcatgttc
aagtgccgactgtgcatgatgggcttccgccggagggggatgttggtgaatcatctatca
aagagacatccagacatgaaaatagaagaggtgccagagctcacgttgcccatcatcaaa
cccaacagagattatttctgtcagtactgtgataaggtgtacaagagtgccagcaaacgc
aaagcacatatcctgaagaaccatcctggtgctgagctacctccaagcatccggaaactg
cgtcctgcaggcccaggagagccggatcccatgctgagcacccacacccagctgacggga
actatagccacccctccagtctgctgtcctcattgttccaaacagtacagcagtaagaca
aagatggtacaacacattcgcaagaagcacccggagtttgctcagctccctaacactata
catgccccactggcgacagctgtcatcagttccactcctgcagtcctcaccactgacagc
actaccggagagactgttgtgacaacagacttactgacacaagcaatgacggagctatct
cagaccctcacaacagactatcgaactccccagggagactaccagcgaattcagtacatc
cctgtgtctcagtccacaactggcttgcagcagcctcagcacatccaactgcaggttgtt
caagtggcccaggctacctcacctcaccagtctcagcactccacagtggacgttggacag
cttcatgacccccagacatatactcagcatgccatccaggtgcagcacatccaggtcacg
gagccatcacccacagctcagtcatcatcgcaggttgggggtcagcctctgagtccctcc
tcacaacaatcacagcaggaactcagcccctcgcagatgcagacagctgcatctacacaa
agccaagccctccagcagcagcaaggatcttcagtccagcacacatatcttcccagcacg
tggaactcatttcagagttattcatccgagattcagatgatgaccatccctcaaggccaa
tatgtcatcacagagacagctgtaggtacacctgtcaccactgtcaacacaggacaagtg
aaagcagttactcagactcactatgtgatatctgaaggtcaacctgatctggatgtcaaa
cagaactcctcactctccagtgaggtacaggttggtgtttcccagccaccaacccacact
gacacgctggaatctcaaacgagtaatcagcagcaaacaacccagtacataatcactaca
accaccaatgggaacgggggcagtgaagtgcacatcactaaaccaaggactttctcagca
gaacacgaatga

DBGET integrated database retrieval system