KEGG   Gallus gallus (chicken): 419752Help
Entry
419752            CDS       T01006                                 

Gene name
ARHGEF12
Definition
(RefSeq) rho guanine nucleotide exchange factor 12 isoform X2
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
gga04625  C-type lectin receptor signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    419752 (ARHGEF12)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    419752 (ARHGEF12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    419752 (ARHGEF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    419752 (ARHGEF12)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    419752 (ARHGEF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ_6 PDZ PDZ_2 PH_13 Ribonuc_2-5A Tricorn_PDZ Mga DUF3967
Motif
Other DBs
NCBI-GeneID: 419752
NCBI-ProteinID: XP_015153669
CGNC: 51082
Ensembl: ENSGALG00000006663
UniProt: A0A1D5PUV1
Position
24
AA seq 1525 aa AA seqDB search
MSGTQPATTDRFPLKKPTRHGSILSRESPADKKQKVERCSSTHDFDPTGLVQRCVVIQRD
ENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGS
YVALTVQGRPPGSPQIPLADSEVDLAAFGHMSPIMTSPHSPGTSGNAERITSPVLMGEEN
NIVHNQKVEILRKMLQKEQERLQSLQEEYGRSASSRLLREIQETKKHITQLQEQLSKATG
CAQDGVLSSRSVAESLQVSEVEAESGDALSKLDYSSDSPSRPNSDIADSPRSGLKERVYL
DESPEKTELQDTDSQSSIGSPSSRVGPQIIGAEDDDFDTEQEQINGQCSCFQNIELLKSR
PAHLAVLLHHVVSQFDPAALLCYLYTDLYKQTNAKETRRVFLEFYQFFLDRAANLKVPIP
DEISVDLEKRRPELIPEELHRHYIQTMQDKVCPEVQRNLEDFRQKRSMGLTLAEGELTKL
DAERVRDRNAVEKERACAEQIIAKIEEVLMTSQPLEEDKSSTIQYVILTYMKHLGVKAKE
ARNLEQKRGRIGFLPKIKQSIKKEKEGDEKGKRRGFPNILGPPRRPSRHDSSAIGRAMEI
QKQRHQKHIPAVPSVSPEPPDSGKVRQSGSSSDGTDAPYPPANPMSPLAVGPFSSPEGNK
DSESGSKQTGEAPPANECVDGTPRTPNTTFEFPSPLENLPEEEGESERVVDMGTPKPFRK
MDSVGFADVQSEDELYDFDMDTDPPNWQQLVSREVLMGLKPYEIKRQEVINELFYTERAH
VRTLKVLHNVFYQRVTREGILNSSDKRKIFSNLEDILGLHVALNDQMKAVRKRNETSVID
QIGEDLLSWFSGAAEEKLKHATATFCSNQPFALEVIKSRQKKDSRFQTFVQDAESNPLCR
RLQLKDIIPTEMQRLTKYPLLLDNIAKYTELPEEKEKVKKAADHCRQVLNHVNQAVKESE
NKQHLEDYQRRLDLSYLKQSEDPMMDEFRNLDLTKRKMLHEGPLTWKVNRDKTIDLYTLL
LEDILVLLQKQDDKLVLKCHSKILASTADSKHTFSPIIKLNTVLVRQVATDNKAFFVISM
SENGAHIYELVAQTVSEKNVWQDLIAQMAGNVKMESSRRVIPLPQSGPGEEEREEEEQQK
LKDQHDIPASSLQSPDKDLVLDSPLILNAQTSPTMSEKSEVESLLVAEGQFDKVQQADLA
LKESSPCYEHTATNLPLVAGGQWALDALRNLDLLKKLLVQQLGFAEKGTLEDRQRFPRFR
TVSQEAQTESGSELGLQHSDHNKLHQPAADPTLPRSGANEPTANYGLRTSAESPAPGDAM
QLGARDPRPSSNLAMDRVGMNLEVSAAELEGVGADESGEHFFDAREAHSDENPSESELME
RKDEEDVQIRISGNYLILDGYEAVQESSTDEEVSSLVLQGAAGGSTSLDSAQQQPLSPRD
TQSDGGSSPFAEEMMVTRWGGVEEPCTVVANPPFWSIESRVQMMQYIQKIENDLEKLKEV
EEDYIILRRQGLAGSASTGEHSEKS
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcacacagcccgcaaccacggacaggtttcctctcaaaaaacctacaaggcac
ggcagcattctgagcagagagtctccagccgacaagaagcagaaggttgagcgctgcagc
agcacccacgacttcgatccgacaggtcttgttcagcggtgtgttgttatccaacgggat
gaaaatggatttgggctgacagtcagtggagacaacccagtcttcgtgcagtccgtcaaa
gaagatggagcagccatgcgagcaggagtgcaaacgggtgatagaattatcaaggtgaat
ggcactcttgtaacacactcaaaccatttggaggtggtaaagctgatcaagtcgggttcc
tatgtagctctcactgttcaggggcgcccaccggggtcgccccagattcccttggctgat
tctgaagtggatctggcagcatttgggcatatgtctcccatcatgacatctccccattcg
cctggcacatcaggaaatgcagaaaggattactagcccggtgcttatgggggaggagaat
aatattgtccacaaccagaaggtggagattctgagaaagatgctacagaaagagcaggag
cggctgcagtctctgcaagaagagtacggccgatctgccagctcacgactgctcagagag
atacaggaaacaaagaagcacattactcagctgcaggagcagctgtccaaagccacaggc
tgtgctcaggatggagttttgtcctccaggtctgtggcagaatcgctgcaggtcagtgaa
gtggaggcagagagtggggatgctctgagcaaactggattacagtagtgacagcccctct
cgaccaaacagtgacattgctgatagtcctcgcagtggcctgaaggagcgggtttatctg
gatgagagcccagagaagactgagcttcaagatactgattctcagtccagcattggaagt
ccttcatcccgtgtgggaccacagatcattggagcagaggatgatgactttgacactgag
caggagcagataaatggacaatgcagttgtttccaaaacattgagctcctgaagtctcgc
ccagctcacctggctgttcttctgcaccatgtggtgtcccagtttgaccctgcagcattg
ttgtgctacctttacacagacttgtacaagcagaccaatgcgaaagagactcggcgtgtc
ttcctggagttttaccagttcttcttggaccgagctgcaaatcttaaagttccaatacca
gatgaaatctccgtagatctagagaaaagaaggccagaactcattccggaagagcttcat
cgccactatatacaaactatgcaagataaagtctgtccagaagttcagaggaatctggaa
gatttcaggcagaaacgtagtatgggtttgaccctggcagagggggagttgaccaagttg
gatgcagaaagggttcgtgaccggaacgcagtggagaaggaaagagcatgtgcagaacag
attattgccaaaattgaggaagtcctgatgacatcccaacctttggaggaagacaagagt
tccaccatacagtatgtgattcttacttacatgaagcacctcggagtcaaagctaaagag
gctcggaacctggagcagaagcgtggccgtattggtttcttgccaaagatcaagcaaagt
atcaagaaagagaaagaaggagatgaaaaaggaaagaggagaggctttcctaatatcttg
ggcccaccgaggagacccagccgacatgacagcagtgcaattggcagagccatggagata
cagaagcagcgccatcaaaagcacatccctgcagtgccttctgttagcccagagcctcca
gattcaggcaaagtgcgccagagtgggtcctccagcgatggcacagatgcgccgtaccca
cctgccaacccaatgtctcctttggcagtgggtcctttttcatctccagagggaaacaag
gacagtgaatcaggctcgaagcagacgggagaagccccacctgctaatgagtgtgtggat
ggcacaccccgcacacccaatactacttttgaattcccatctcccttggaaaacttgcca
gaggaggagggagagtcagagagagtggtcgacatggggacaccaaagccttttcgcaag
atggacagcgttggttttgcagatgtacaaagtgaagatgagctgtatgactttgacatg
gacacagaccctcctaactggcagcaacttgtaagccgagaagtgttgatggggctgaaa
ccctacgagatcaagaggcaagaagtgattaatgagttgttttacactgagagagctcat
gtccgcaccctgaaggttctgcataacgttttctaccagcgtgtcacccgggaagggatc
ctcaactccagtgacaaaaggaagatcttctcaaacctggaggatatcctgggccttcat
gtcgcattgaatgatcagatgaaagcggtccggaaaaggaatgagacttctgttattgac
caaattggggaggacttgctttcttggttcagtggagcagcagaggagaagctgaaacac
gccactgccacgttctgcagtaaccagccctttgctctagaggtcataaagtcccgtcag
aagaaggactctcgtttccagactttcgtgcaggatgctgaaagtaatcccctgtgtcgc
cgcctgcagctgaaggatatcattccaacagagatgcagaggttgacaaagtaccccctt
ctgctggataacattgcaaagtacacagaactgcctgaagagaaggagaaagtgaagaaa
gcagcagatcattgccgtcaggtccttaaccacgtgaaccaggccgtcaaggagtcggag
aataagcagcacctggaagattatcagcgtcgtcttgacctgtcctacttaaagcagtct
gaggatcccatgatggatgagttcaggaacttggatctcacaaagagaaaaatgcttcac
gaaggacctttgacttggaaggttaatcgtgacaaaactatcgatctctacactctgctc
ttggaggacattctggtcctgttgcagaaacaagatgataagctggtcttgaagtgtcac
agtaaaatcttggcgtcgacagctgatagcaagcacaccttcagtcctatcatcaaactg
aacactgttctggttcgtcaggtggcaacagataacaaagctttcttcgtcatctccatg
tcagaaaatggtgctcacatttacgagctggtggcacagacagtttcagagaagaacgta
tggcaggaccttatagctcagatggcagggaatgtaaaaatggagagcagcagaagagtg
attccattaccgcagtcaggacctggcgaagaagagcgtgaagaagaggagcagcagaag
ctcaaagaccagcatgacattcctgccagtagcctacaaagcccagacaaagatctggtc
ctggactctccattgatactgaatgctcagacttcacccaccatgtctgaaaagtccgag
gtggaaagtcttctcgtggcagaaggacagtttgataaagtgcagcaggcagacctggcc
ctgaaggagtcttctccgtgctatgagcacacagccaccaatttacctttggtagcagga
gggcagtgggcattggatgcattaaggaacctggacttgctgaaaaagctgttggtccaa
cagcttggctttgctgagaaggggacccttgaagaccggcagcgctttcccaggttcagg
accgtctctcaagaggcacaaacggagagtggaagtgagcttggacttcagcactccgac
cataacaaattgcaccagcctgcagcagaccccacgcttccgagaagcggagctaacgag
cccacagctaattatggcctccggacttcagctgaatcaccagctccaggggatgccatg
cagctgggagcgagagaccccagacccagcagtaacttagcgatggaccgcgtgggtatg
aatctggaggtctccgccgcagagctggaaggggtgggtgctgatgagagtggggagcat
ttctttgatgcccgagaagctcacagtgatgaaaatccgtctgaaagtgagctaatggaa
aggaaggacgaggaggatgtgcaaatacggatctcaggaaattatttgatccttgatgga
tatgaagcagtgcaggagagctccacggatgaggaggtgtcgtctctggttctccaaggt
gctgcaggtggtagcacctctttggactctgcacagcagcagcccctttccccacgggac
acacagtcagatggagggagctccccgtttgcagaggagatgatggttacccgctgggga
ggagtggaagagccctgcacagttgtagcaaaccctcccttctggtctatagagtcacgc
gtgcagatgatgcagtatattcagaagatagagaacgaccttgaaaagttaaaggaggtt
gaggaagactacatcattctccgtcgtcaagggctggctgggtcagcctccacaggagag
cactcagagaaaagttag

DBGET integrated database retrieval system