KEGG   Gallus gallus (chicken): 419762Help
Entry
419762            CDS       T01006                                 

Gene name
CADM1
Definition
(RefSeq) cell adhesion molecule 1 isoform X3
  KO
K06781  cell adhesion molecule 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    419762 (CADM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    419762 (CADM1)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  Necl family
   419762 (CADM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set C2-set_2 Izumo-Ig Adeno_E3_CR1 Syndecan
Motif
Other DBs
NCBI-GeneID: 419762
NCBI-ProteinID: XP_015153700
CGNC: 10821
Ensembl: ENSGALG00000014582
Position
24
AA seq 488 aa AA seqDB search
MAARAQHSGPAANGGGAPALLPLLLLLLSAAAIIPRGDGQNLITEDVTVVEGDVATISCR
VKNSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLVNFSNSELRVSLTNVSISDEGRYFCQ
LYTDPPQEIYTTITVLVPPRNLVIDIQKEIAVEGEEIELNCTAMASRPATTIRWFKGNKE
LTGKSEVEQWSDMYTVTSQLLLKVGREDDGVPVICLVDHPAVKDLQTQRYLEVMYKPQVR
VSQNYPVQGLTREGEPLELTCAAFGKPQPTDMRWLRVDDEMPQHVVVSGSNLLISNLNKT
DNGTYRCEASNAVGKSHADYMLFVYDPPTTIPPPTTTTTTTTTIPTTITDTTATTEPAVH
GFTQLPNSAEELDYGDLSGTGVLLNASTEALPTVQISNASIALHPDSRAGEEGAIRSVDH
AVVGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNS
EEKKEYFI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgcgcgcagcacagcggccccgcggcgaacggcggcggcgctccggccctc
ctcccgctgctcctcctgctcctctccgccgccgccatcatccccagaggtgatggccag
aacttgataacagaagatgtgacggtagtggagggggacgttgccaccatcagctgtcga
gtcaaaaacagcgacgactccgtgattcagctccttaatcccaacagacagaccatttat
ttcagagatttcagaccgctgaaggacagcaggtttcagctggtgaatttctccaacagt
gagctccgagtgtcgctgacgaacgtctctatttctgatgaaggacggtacttctgccag
ctctacacggatccgccgcaggaaatttacaccaccatcacagtgctggtcccaccacgc
aatttggtaattgatatccagaaagaaatcgctgttgagggagaagagattgagctgaac
tgcactgccatggccagcagaccagccaccaccatcagatggttcaaaggcaacaaggag
ctgactggcaagtcagaagtggagcagtggtctgatatgtacacagtgaccagccagctt
ttgctgaaagtgggacgggaggacgacggggtccctgtcatctgcttggtggatcacccc
gctgtcaaagacttgcagacacaacgctacctagaagtcatgtataagcctcaagtgcgg
gtttctcagaattacccagtgcaaggcctcacgagagaaggggagccgcttgaactgacg
tgcgcagcttttggaaaaccacagcctacggacatgaggtggttaagagtagatgatgag
atgcctcaacacgttgtagtgtctggttcaaaccttctcattagtaacctaaacaaaaca
gataatggtacataccgctgtgaggcttcaaacgcggtggggaaatcacatgcggattac
atgctgtttgtatacgatccccccacaactatccctcctcccacaacaaccaccaccact
accaccaccatccctaccaccatcacagacacaacggcgacgacagaaccggcagttcac
ggctttactcagttgccaaattccgcagaggagctggactatggggatctctcaggtact
ggtgtcctgctaaatgcttcaacggaggctctgccaactgtacaaataagtaatgcatct
attgccttgcatccagattctcgtgcaggtgaggaaggggcaataaggagcgtggaccat
gcagtcgtcggtggtgtcgtggccgtggttgtatttgccatgctttgcctgctcatcatt
ttagggcgatattttgcaagacataaaggtacatatttcactcacgaagccaaaggagcg
gacgatgcagccgacgcagacacagctatcatcaatgcagaaggaggacaaaacaactcc
gaagaaaagaaagagtacttcatctag

DBGET integrated database retrieval system