KEGG   Gallus gallus (chicken): 419802Help
Entry
419802            CDS       T01006                                 

Gene name
APOA5
Definition
(RefSeq) apolipoprotein A-V isoform X1
  KO
K09025  apolipoprotein A-V
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    419802 (APOA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    419802 (APOA5)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Others
   419802 (APOA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein ApoLp-III DUF4795 Dynamin_M Syntaxin_2 Fzo_mitofusin Prominin FliT Fib_alpha DUF1043 Trans_reg_C PIN_8 Amidase BAG6
Motif
Other DBs
NCBI-GeneID: 419802
NCBI-ProteinID: XP_024998987
CGNC: 10694
Ensembl: ENSGALG00000014368
UniProt: E1BT17
Position
24
AA seq 378 aa AA seqDB search
MKPQSIPSSHPHSTTPPALCFPKLCSVSSHLWAAPITTALLLAVSPAELARSGFWEYLSQ
LTSDKDSLEQAQGSKLGREFTNLKESLQDRVSNVGNFLEKLAPLHRGIHPRLYHDSDSLR
KLIRKELESLRVKLSPYVDDVHHRVGKHLEDLRYQLQPFTEELLDQVSLRARELQRHLTP
SRDVAAQLLDGVDEVQRFMAHYADKIAFHTDQVKDIFQPYADRLVSEIQRSVEELHRNVV
PHSPGSPEQLNQHIRELSAKLTQNARDLHRNIQRNLEQLKAKLSLRPGGPGERYAEEMAS
EVQRRIEEFRRDTYLQIQDFTRAVHQETEDMRLKLSSRPHYPEEAAGSPAPLEDLRASLD
ALWRDLSHSLSERGGDAP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagagcatccccagctcacatccacactcaaccaccccacctgctctgtgt
ttccccaagctttgctctgtatcctcacatctatgggctgctccaataaccaccgccctt
ctccttgcagtgtcaccagccgagctggcacggagtggcttctgggagtacctcagccag
ctgaccagtgacaaggacagccttgagcaggcacagggcagcaagctgggcagggagttc
acaaatctgaaggaaagcctccaggatagggtcagcaacgtggggaacttcctcgagaag
ctggcacctctccacagaggcatccacccacggctgtaccacgactccgacagcctgcgg
aagctcatcaggaaggagctggagagcctgagagtgaaactgtccccttacgtggacgac
gtgcaccacagagtcggcaagcacctggaagacctccgctatcagctgcagcccttcacc
gaggagctgctggaccaggtgtccctccgtgcgcgggagctgcagcggcacctgacgccc
agccgcgacgtggcggctcagctgctggacggcgtggacgaagtgcagcgcttcatggct
cactacgccgataagatcgccttccacaccgaccaggtgaaggatatcttccagccgtac
gccgacaggctggtgagcgagatccagcgctcagtggaggagctgcacaggaacgtggtg
ccgcacagccccggcagcccggagcagctcaaccagcacatccgtgagctgtccgccaag
ctgacgcagaacgcgcgggatctgcaccgcaacatccagcgcaacctggagcagctgaag
gccaagctcagccttcgccccggtggccccggggagcgctacgccgaggagatggccagc
gaggtgcagcggcgcatcgaggagttccgcagggacacctatctccagatccaggacttc
acgcgggccgtgcaccaggagacggaggacatgaggctgaagctgtcctcccggccccac
tacccggaggaggccgcgggcagcccggccccgctggaggacctgcgggccagcctggac
gcgctgtggagggatctgtcgcacagcctgagcgagcgcggcggggacgcgccctga

DBGET integrated database retrieval system