KEGG   Gallus gallus (chicken): 419825Help
Entry
419825            CDS       T01006                                 

Gene name
CNTN2
Definition
(RefSeq) contactin-2 precursor
  KO
K06760  contactin 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    419825 (CNTN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    419825 (CNTN2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    419825 (CNTN2)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  Contactins
   419825 (CNTN2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Others
  419825 (CNTN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_5 Izumo-Ig Pur_ac_phosph_N C2-set_2 Interfer-bind
Motif
Other DBs
NCBI-GeneID: 419825
NCBI-ProteinID: NP_001004395
CGNC: 412
Ensembl: ENSGALG00000000653
UniProt: P28685
Structure
PDB: 

Position
26
AA seq 1036 aa AA seqDB search
MGGTAAFICTSLAVIICVVWCQAQSGMRSYGPVFEEQPAHTLFPEGSAEEKVTLTCRARA
NPPATYRWKMNGTELKMGPDSRYRLVAGDLVISNPVKAKDAGSYQCVATNARGTVVSREA
SLRFGFLQEFSAEERDPVKITEGWGVMFTCSPPPHYPALSYRWLLNEFPNFIPADGRRFV
SQTTGNLYIAKTEASDLGNYSCFATSHIDFITKSVFSKFSQLSLAAEDARQYAPSIKAKF
PADTYALTGQMVTLECFAFGNPVPQIKWRKLDGSQTSKWLSSEPLLHIQNVDFEDEGTYE
CEAENIKGRDTYQGRIIIHAQPDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQ
PLASQNRIEVSGGELRFSKLVLEDSGMYQCVAENKHGTVYASAELTVQALAPDFRLNPVK
RLIPAARSGKVIIPCQPRAAPKATVLWTKGTELLTNSSRVTITADGTLILQNISKSDEGK
YTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGENLTLQCHASHDPTMDLTFTWS
LDDFPIDLDKSEGHYRRASVKEAVGDLAIVNAQLKHSGRYTCTAQTVVDSTSESATLTVR
GPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIARYSIEARTLLSNKWKQMRTNPVNIEG
NAETAQVVNLIPWMDYEFRVLASNILGVGEPSLPSSKIRTKEAAPTVAPSGLGGGGGAPN
ELIINWTPTLRDYQNGDGFGYILSFRKKGTQGWLTARVPHAESLHYVYRNESIGPYTPFE
VKIKAYNRKGEGPESLTAIVYSAEEEPKVAPFRVTAKAVLSSEMDVSWEPVEQGDMTGVL
LGYEIRYWKDGDKEEAADRVRTAGLVTSAHVTGLNPNTKYHVSVRAYNRAGAGPPSPSTN
ITTTKPPPRRPPGNISWTLTGSTVTIKWDPVVAQADESAVTGYKMLYRQDSHSAPTLYLA
SKSRIDIPVPEDFTHAFVQIRVTGPGGDGTPAEVHIVRNSGTSMMVEDSVTRPVPHAAII
TTNSLAMVALIRYLEL
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcactgctgcattcatctgcacctccctggccgtcatcatctgcgtggtctgg
tgccaagcacagagtggcatgaggagctacgggccggtgtttgaggagcagccagcacac
accctgttccctgaaggctcagcagaagagaaagtgacgctgacgtgtcgagccagagcc
aacccccctgcaacatacagatggaagatgaacggcacagagctgaagatggggccggat
tcacggtacaggttggttgctggggacctggtgataagcaacccagtgaaagcaaaggat
gcaggctcctaccagtgtgtggcaaccaacgcccgtggcacagtggtcagcagggaagca
tccctccgctttggctttttgcaggaattctctgcagaagagcgagaccccgtgaagatc
accgaaggttggggagtgatgttcacctgcagcccccctccccattacccagccttgtcc
taccggtggcttctgaatgagtttcccaacttcatcccagccgacggaaggcgtttcgtc
tctcagaccacaggaaacctctacattgccaagacagaggcttccgacctcggcaactac
tcgtgctttgccaccagccacatcgacttcatcaccaagagcgttttcagcaagttctcc
cagctcagcctggctgccgaggacgccaggcagtatgcacccagcataaaagccaagttc
cctgcagacacctacgctctgaccgggcagatggtgactctggagtgtttcgcctttggg
aaccccgttcctcaaataaagtggaggaagctggatggctcgcagacctccaagtggctc
tccagtgagcccctcctgcacatccaaaatgttgactttgaagatgaaggcacttatgag
tgcgaggctgaaaacatcaaagggagggacacctaccagggccgcatcatcattcacgct
cagccggactggctggatgtgatcacggacacggaagctgacattgggtccgacctgcgc
tggagctgcgtggcatccggcaaaccccggccagcagtgcggtggctgcgggatgggcaa
cctctggcctcccagaaccgcatcgaagtgagcggtggagagctgagattttccaagcta
gtcctggaggactctggcatgtatcagtgtgtggctgagaacaagcatggcacagtatat
gcaagtgctgaattaacagtgcaagccttagcaccagattttagactaaacccagttaaa
cgactgatacctgcagcccggagtgggaaggtcatcatcccatgccaaccgagagcagca
ccaaaagccactgtgctctggaccaaagggaccgaactgctcaccaacagcagcagggtg
actattactgctgatggcaccttgatcctccagaacataagcaaatctgatgagggaaag
tatacctgctttgctgagaatttcatgggcaaagccaacagcacggggatcctctctgtt
cgagatgccaccaaaatcacactggcaccatccagcgctgatatcaatgtgggtgaaaac
ctcactctgcagtgccacgcatcccacgacccaaccatggacctaaccttcacctggtca
ctggatgatttccccattgacttggacaagtcggaggggcattaccggcgagccagcgtg
aaggaagctgttggggaccttgccatcgtcaatgcccagctgaagcactcggggcggtac
acatgcacagcccaaacggttgtggacagcacttcggagtcggccacgctgactgtcaga
ggaccccccgggcccccagggggtgtggtggtgagagacattggtgacaccactgtccag
ctgagctggagccgtggctttgacaaccacagccccatcgccaggtacagcattgaggcc
aggacgctgctctccaacaaatggaagcagatgcgcaccaatcctgtaaacatcgaaggc
aacgccgagacagcccaggtggtgaacctcatcccttggatggattacgagtttcgggtc
ttagcaagtaacatccttggagttggggagccaagcttaccctccagcaaaatccgtacc
aaagaagcagcacccacggtggcaccatctgggctcggcggcggcggtggggctcccaat
gagctcatcatcaactggacgccaacactgcgggactaccagaatggagacggcttcggc
tacatcctgtcgtttcgtaagaagggcactcagggatggctcactgcccgcgtgcctcat
gcagaatccctgcattacgtgtaccgcaacgagagcattgggccctacacccccttcgag
gtgaagatcaaagcatacaacaggaaaggagagggaccggagagcctcactgccatcgtg
tactctgcagaagaagaaccaaaagtggctccattcagagttacggccaaagccgttcta
tcctcagaaatggatgtgtcctgggagccagtggagcagggagacatgactggtgtgctg
ctgggctatgagatccggtactggaaagacggcgataaagaggaggcagctgacagagtg
agaacagcagggttggtcacatcggctcacgtcacaggcctaaatcccaacacgaagtac
cacgtctcagtgagagcctacaaccgtgctggagctgggccccccagcccctctaccaac
atcacgaccacaaagccaccaccaaggaggccaccaggcaacatctcctggactctgact
gggtctaccgtcaccatcaagtgggacccagtggtggcacaggcagatgagtctgcagtt
acagggtacaagatgctttacaggcaggattctcactctgctcccacgctgtacctggcg
agcaagagccggattgacatcccagtgcctgaggacttcactcatgccttcgtacagatc
cgggtgacggggcctgggggggacgggaccccagcagaagtccacatcgtccgaaacagt
gggaccagtatgatggtggaagactccgtgacgaggccggtgccacacgctgccatcatc
accaccaactccctggccatggtggccctgatccgctacctggagctctga

DBGET integrated database retrieval system