KEGG   Gallus gallus (chicken): 419832
Entry
419832            CDS       T01006                                 

Gene name
ELK4
Definition
(RefSeq) ETS domain-containing protein Elk-4
  KO
K04376  ETS domain-containing protein Elk-4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    419832 (ELK4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419832 (ELK4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    419832 (ELK4)
SSDB
Motif
Pfam: Ets HSF_DNA-bind CCDC24
Other DBs
NCBI-GeneID: 419832
NCBI-ProteinID: XP_417965
CGNC: 443
Ensembl: ENSGALG00000042137
UniProt: A0A1D5PLC6
Position
26
AA seq 448 aa
MDSAITLWQFLLQLLKEPQNKNIICWTSNDGEFKLQQAEEVARLWGIRKNKPSMNYDKLS
RALRYYYVKNIIKKVNGKKFVYKFVSYPEILKMDPLVVGRIEGEPDLTGFAEVSSAPKDM
ESCGKEKSQSCAKSSSRNDYIHSGLYSSFTLNSLNSSNVKLFRSIKIENPAEKLTEKKAA
QDPTPSVIKFVTMPSKKPPSVPLIATTSAASATSTASATSTASSLPMGSEETLQTLETLV
LPKLTIPEAPAPLPNLTTSFTPTPPVSSVSPVLQVPSTPPSPPLSSNPDLDIDTDIESVA
SQQLEQAQSLQHQSPEPKEQDSSVLEKEFANHLSRSKKPKGLELAPTLVITGSDPSPLGI
LSPSLPTASLTPALFSQTPILLTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSV
LNSHGPFTLSGLDGPSTPGPFSPDLQKT
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggacagtgctatcaccctgtggcagttcctcctccagctcctgaaagagcctcagaac
aagaatatcatctgttggacctccaatgacggggagttcaaactgcagcaggcagaggag
gtggccagactgtggggaatccgcaagaacaagcccagcatgaactatgataaactcagc
cgtgctctcagatactattatgtgaagaatatcattaaaaaagtgaatggtaagaagttt
gtgtacaagtttgtttcttatccggagatcttaaaaatggatccacttgtcgtgggccgg
atagaaggagagcccgacctgaccggctttgcagaggttagcagtgctccaaaggacatg
gaaagctgtgggaaggagaagtctcagtcgtgtgctaaatcctccagccgcaacgactac
atccactcaggcttgtactcctcttttacgctgaactccctgaactcttccaatgtaaaa
ctcttcaggtccatcaagattgagaatccagctgagaaactgacagagaagaaagctgct
caggatccaacgccgtctgtcatcaagtttgtcaccatgccctccaaaaagcctccatcc
gtccccctgatcgccaccacttcagcggcctctgctacatccactgcttctgccacctca
actgcatcctcccttcccatgggatcagaagaaactctgcagaccttggagactcttgtt
ctccccaagttaactatccctgaagctcctgcacctttgccaaacttgaccaccagcttt
accccaactccacctgtatcctcggtttctcccgttctgcaagttccttccaccccccca
tcgcctcccctgagttctaatcctgacctggacattgacacggacatagaatcagtggct
tctcagcagctggagcaggctcagagccttcagcatcaatccccagagcccaaagagcag
gattcatctgtgctggagaaggaatttgccaatcacctctccagatctaaaaaacccaaa
gggctggagttggctcccactctcgtcattacaggcagtgatccaagtccattgggaata
ctgagcccttccctccccactgcttctcttactccagcacttttctcccagactcccatc
ttgctgaccccaagtcccttgctctccagcattcatttctggagtaccctcagccctgtt
gctcctctcagtcctgcaaggttgcaaggtgctaatacgctctttcagtttccatcagtg
ctgaacagtcacggcccattcacgctgtctggactggatggaccctctacccctggccca
ttttcccctgacctgcagaagacatag

DBGET integrated database retrieval system