KEGG   Gallus gallus (chicken): 419857
Entry
419857            CDS       T01006                                 
Symbol
PLXNA2
Name
(RefSeq) plexin-A2 isoform X1
  KO
K06820  plexin A
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 Sema TIG_plexin PSI RasGAP PSI_integrin
Other DBs
NCBI-GeneID: 419857
NCBI-ProteinID: XP_015154527
CGNC: 863
Ensembl: ENSGALG00000001264
Position
26:complement(2754008..3101360)
AA seq 1893 aa
MDRRRTCPWALRSDGDGRSASLLCLLLASLSWSASGSASFSTFHSEHRDWTFNHLTVHRS
TGAVYVGAINRVYKLSGNLTILVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLLI
IDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGE
DGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALISH
FDIFYIYGFASGNFVYFLTVQPDTPEGVSNSASDLFYTSRIVRLCKDDPKFHSYVSLPFG
CVRGDTEYRLLQAAYLSKPGDVLAKSLNITAHEDVLFAIFSKGQKQYHQPPDDSALCVFP
IRAVNAQIKDRLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSVPV
DGVTLFTSSRDRMTSVASYIYNGYSVVFVGTKNGKVKKIRADGPPHGGIQYEVVTVFKDG
SPVLRDMAFSIDHKYLYVMSERQVSRVPVESCEQYTTCAECLSSGDPHCGWCTLHHTCSP
RDSCERADEPHRFADSIGQCMSIMVQPSSISVSQHSLPLNLLVSDAPDLAAGVTCLFGNL
TEVEGQVVGSRVVCVSPAARDVPAIPVDQDWFGVVLQLKSQETGRTFVSTEFKFYNCSAH
QLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINVSEDCPQLFPTEEILIPVGEVKP
ITLKARNLPQPQSGQRGYECVLSIQGVIHRVPALRFNSSSVQCQNSSYLYDGMDISNLAV
DFAVVWNGNFIIDNPEDVKVHLYKCAAQRESCGLCLKADPKFECGWCSGEGRCTLRPHCS
PQPWLDWSSRNVKCSNPRITEILTMSGPPEGGTRVTIRGVNLGLDFSEIARGVQVAGVPC
APLPEQYIVAEQIVCEMGQALPGISSGPVLLCIGECKPEFTAKSVQHYTFVTPTVSFLSP
SRGPESGGTLVTITGHHLGAGSRVSVLLGNQSCAFQGRSMNEIVCLSAPSAHGLGPVHVS
VSVDRAQLEQTLLFEYIDDPKVQHIEPEWSIASGHTPLTITGSNLDVIQEPRIRVKHNGR
ESINVCVVLNATALSCLAPALTPEPRPTMDAIERPDEFGFIFNNVQSLRVYNDTKFIYYP
NPTFEPLSSSGMLEQKPGSPIILKGKNLCPPASGGAKLNYTVLVGETPCTVTVSETQLLC
EPPTLSGQHKVTVRVGGVTFSPGSVSITSDSLLTLPAIVSIAAGGSLLLIIVIIVLIAYK
RKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYA
MRVLFPGIEDHPVLRELEVQGNGQQSVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMR
DRGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKMLTNW
FAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLI
LNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRIA
RVVLQDEDITTKIEGDWKRLNTLLHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRY
DSTFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRL
LATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADKHGIHDTDVRHTWKSN
CLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYA
KDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHSVEFNMLSALNEIYSYVSKYS
EELIGALEQDEQARRQRLAYKVEQLIGAMSIES
NT seq 5682 nt   +upstreamnt  +downstreamnt
atggatcggaggaggacctgcccttgggcactgcgctccgacggcgatggcaggtcagca
tctctgctctgcctcctcctggcatcgctctcctggagcgcatccggcagtgcctcattc
agcactttccattctgagcaccgggactggactttcaaccacctgaccgtccaccggagc
accggggcggtttacgtcggggctatcaatagggtttacaagctttcgggtaacttgacc
attttagtggctcacaaaaccggtcccgaggaggacaacaaatcctgctaccctcccctc
atcgtgcagccctgcagcgaggtgctgaccctcaccaacaacgtcaacaagctgctgatc
atcgactactccgagaaccggctgctggcctgcggcagcctgtaccagggggtgtgcaaa
ctgctgcgcctggacgacctgttcatcctggtggagccctcgcacaagaaggagcactac
ctctccagcgtcaacaagacaggcaccatgtacggcgtcatcgtgcgctccgagggcgag
gatgggaagctcttcattggcacggcagtggatgggaagcaggattatttccccacgctc
tccagccgcaagctgccccgcgacccggagtcgtcggcgatgctggattatgagctgcac
agtgactttgtctcgtccctcatcaaaatcccctcagacaccttggccctcatttcgcac
tttgatatcttctacatctacggctttgccagcggcaacttcgtctatttcttgactgtc
caaccggacaccccggagggcgtctccaactccgccagtgacctcttctacacgtcccgc
atcgtccggctctgcaaagatgaccccaagttccactcctacgtctctctgcccttcggc
tgcgtcaggggggacacggagtaccgcctgctgcaggcagcctacctgtcgaagccaggg
gatgtgctggccaaatccctcaatatcacagcccacgaggatgtcctctttgccattttc
tccaagggacagaagcagtaccatcagccgccggatgactccgcgctctgtgtcttcccg
attcgtgctgtcaatgcccagatcaaggacaggctgcagtcgtgctaccagggggagggc
aacctggagctcaactggctgctggggaaggatgtccagtgcaccaaagcgcctgttcca
attgatgacaatttctgtgggctcgacatcaaccagcccctgggtggctcagtgccagtg
gatggtgtgactctcttcacctccagccgggaccggatgacttctgttgcttcatacatc
tacaatggctacagcgtggtgttcgtggggactaaaaatggcaaagtgaagaagatccga
gcagatggccctccccatggtggaattcagtatgaggtggtgacggttttcaaggacggg
agcccagtgctccgggacatggctttctccattgaccacaaatacctgtacgtgatgtcg
gagcgacaggtgtcccgtgtgcccgtggagtcctgtgagcagtacacgacctgtgcagag
tgcctgagctcgggggacccgcactgcggctggtgcacgctgcaccacacgtgctcccca
cgggacagctgtgagcgggccgatgagccgcaccgctttgccgacagcattgggcagtgc
atgagcatcatggtgcagcccagcagcatctccgtgtcgcagcacagcctgccgctcaac
ctgctggtgagcgatgccccggacctggcagccggtgtcacctgcctgtttgggaacctg
acagaagtagagggccaggtggtgggcagccgagttgtgtgcgtctcaccggctgcgagg
gatgtcccggccatacccgtggatcaagactggttcggtgtggtgctgcagctgaagtcg
caggagacggggagaacgtttgtcagcacggagttcaagttctacaactgcagtgcccac
cagctgtgcctctcctgtgtgaacagtgctttccgctgccattggtgcaagtaccgcaac
ctgtgcacccacgaccccaccacctgctccttccaggagggacggatcaacgtctcggag
gactgcccccagctcttccccacagaggagatcctgatcccggtgggagaggtgaaaccc
atcactctgaaggcccggaaccttccgcaacctcaatctggccaacgtggctatgagtgt
gtgctgagcatccaaggcgtcatccaccgcgtgcccgcgctgcgcttcaacagctccagc
gtgcagtgccagaacagctcgtatctctacgacgggatggacatcagcaacttagcagtg
gactttgctgtggtgtggaacgggaacttcatcattgacaacccggaggatgtgaaagtg
cacctctacaagtgcgcagcacagcgcgagagctgcgggctctgcctgaaggccgacccc
aagtttgagtgcgggtggtgcagcggggagggcaggtgcaccctgaggccccactgcagc
ccccagccctggctcgactggtccagcaggaacgtcaaatgctccaacccacgcatcact
gagatcctgacgatgtcgggacccccagaaggaggcaccagagtgaccatccgcggcgtc
aacctgggcctggacttctcagagatcgcccgcggtgtgcaggtggcaggagtgccctgt
gctcctctgccggagcagtacatcgtcgccgaacagatcgtctgtgaaatggggcaggca
ctccctgggatcagctccggcccagtgcttctgtgcatcggagagtgcaagcctgagttc
acggccaagtcggtgcagcactacacgttcgtgacaccaactgtgagcttcctgagcccc
agccgtggccccgagtcgggggggacattggtgaccatcacggggcaccacctgggtgcc
ggcagccgcgtctccgtgctcctgggcaaccagagctgcgcctttcaggggcgatccatg
aacgagatcgtgtgcctctcagcaccctcagcacacggcctggggcccgtccacgtctcc
gtgagcgttgaccgtgctcagctcgagcagacactgctgtttgaatacattgatgacccc
aaagtgcagcacatcgagcctgagtggagcatcgccagcgggcacacacctctgaccatc
accggctccaacctggacgtcatccaggagccgcgcatccgcgtcaagcacaacggcagg
gagtccatcaatgtgtgcgtggtgttgaatgccacagcactgagctgcctcgcgcccgcc
ctgacccccgagccccggcccaccatggatgccatcgagcgacccgatgagttcggcttc
atcttcaacaacgtgcagtccctgcgggtctacaacgacaccaagttcatctactacccc
aaccccacctttgagcccctgagctccagtgggatgctggagcagaagccggggtcaccc
atcatcctgaagggcaaaaacctgtgcccgcccgcttctggaggagccaaactcaactac
acagtgctggttggagagacgccctgcaccgtcaccgtgtctgaaacacagctgctgtgt
gagccaccgaccctcagcgggcagcacaaagtgacggtgcgtgtcggtggcgtcaccttc
tcccccggttcggtgagcatcacctctgacagcctgctgaccctgccggccatcgtcagc
atcgcggccggcggcagcctgctcctcatcatcgtcatcatcgtgctcatcgcctacaag
cgcaagtcccgggagaacgacctgaccctcaagaggctgcagatgcagatggacaacctg
gagtcccgggtggcactggagtgcaaggaggcttttgcagagctgcagacagacatcaac
gagttaaccagtgacctggaccgctccggcatcccatacctcgactaccggacatatgcc
atgagagtcctcttccctggcattgaagaccaccccgtgctgcgggagctggaggtccaa
ggcaacgggcagcagagcgtggagaaggccctgaagctctttgctcagctgatcaacaac
aaagtcttcctgctgaccttcatccgcacgctggagctgcagcgcagcttctccatgcgc
gaccgcggcaacgtggcctcgctcatcatgacggggctgcagggaaggctggagtacgcc
actgatgtgctgaagcagctgctgtccgacctcatcgagaagaacctggagaacaagaac
caccccaagctgctgctgcgcaggacagagtcggtggctgagaagatgctgacgaattgg
tttgctttcctcctccacaagtttctcaaggaatgtgccggagagccactcttcatgctg
tactgtgccatcaagcagcagatggagaagggcccaatcgatgccatcacgggggaagcc
cgctattcgctcagtgaggacaagctgatccggcagcagattgagtacaagaccctgatc
ctgaactgcgtcaatccagacaacgagaacagtccagagatccctgtgaaggtgctgaac
tgtgataccatcacccaggtcaaagagaagatcctcgacgcggtgtacaagaacgttccc
tattcccagcgaccgagagctgttgacatggacttggagtggcggcagggccgcatcgcg
cgcgtggtgctgcaggatgaagacatcaccaccaagatcgaaggcgactggaagcgcctg
aacaccttgctgcactaccaggtgtcagaccgctccgttgtggctcttgtccccaagcag
acctcctcctacaacatccctgcctccgccagcatctcccgaacgtccatcagcagatat
gattccaccttccgctacactggaagccccgacagcctgcgctcccgagcccccatgatc
accccagacctggagagcggcgtcaaagtctggcacctggtgaaaaaccacgaccatggc
gaccagaaggagggggaccggggcagcaagatggtgtctgagatctacctgacgaggctg
ctggctacaaagggcacgctgcagaagtttgtggatgacctctttgagacgctgttcagc
acggtgcaccgcggcagcgcgctcccgttggccatcaagtacatgtttgacttcttggac
gagcaggcggataagcacggcatccacgacacggatgtgcggcacacgtggaagagcaat
tgcctccctctccgcttctgggtgaacgtgatcaaaaacccccagttcgtcttcgacatc
cacaaaggcagcatcacggatgcctgcctctcggttgtggctcagaccttcatggactca
tgctccacctccgagcaccgcctgggcaaggactccccatccaacaagctgctgtatgcc
aaggacatccccagttacaagagctgggtggagaggtattatgcagacattgccaagctg
ccagccatcagcgaccaggacatgaacgcgtacctggccgagcagtcacgcctgcattca
gtcgagttcaacatgctgagtgcactcaatgagatctattcctacgtcagcaagtacagc
gaggagctcattggggctttggagcaggacgaacaggcacggaggcagcgtctggcatac
aaagtagagcaactcattggtgccatgtccattgagagctga

DBGET integrated database retrieval system