KEGG   Gallus gallus (chicken): 419902Help
Entry
419902            CDS       T01006                                 

Gene name
C26H6orf106
Definition
(RefSeq) uncharacterized protein C6orf106 homolog
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: N_BRCA1_IG UBA_4
Motif
Other DBs
NCBI-GeneID: 419902
NCBI-ProteinID: NP_001026090
CGNC: 2004
Ensembl: ENSGALG00000041792
UniProt: Q5F3N9
Position
26
AA seq 291 aa AA seqDB search
MEGMDVDLDAELMQKFSCLGTTDKDVLIGEFQRLLGFQLSPAGCAFFLDMTNWNLQAAIG
AYYDFESPNINVPSMSFVEDVTIGEGESIPPDTQFTKTWRIQNTGTEVWPPGVCLKYVGG
DQFGHVNMVMVRSLEPQEIADVSVQMCSPSTAGMYQGQWRMCTATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQPDENNLKDPGGSELGTISK
NTWGPAPDQIEQDQNGLSQNSVNLSPSSHSNNLSVVTYSKGFHGPYPFGQS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagggcatggacgtggatttggacgcggagctgatgcagaagttcagctgcttgggt
actaccgacaaggacgtgctgatcggcgagttccagcggctcctcggcttccagcttagc
ccggccggctgcgccttcttcctcgacatgaccaactggaatctacaagccgccattgga
gcctattatgattttgagagtccaaacatcaacgtaccctccatgtcctttgttgaagat
gtcaccataggtgaaggagagtccattcctcctgacacccagtttacgaaaacatggagg
atacaaaacacagggacagaagtatggcctccaggagtttgtctgaagtacgttggggga
gaccagtttggccatgtaaacatggtaatggtcaggtccctggagccccaggagattgca
gatgtcagcgttcagatgtgcagccccagcacagcaggaatgtatcagggacagtggcga
atgtgcactgccacaggactgtattacggagatgtcatctgggtgatcctcagtgtggaa
gttggaggacttctaggagtaacacagcagctgtcatcctttgaaacggagttcaacaca
caaccgcaccgcaaggtagaaggaaactttaacccattcgcctctccacagaagaacagg
caaccagatgaaaacaacctaaaagaccctgggggttctgagctaggcacaatcagcaaa
aacacgtgggggcctgctcctgaccaaattgaacaagatcagaatggactgtcacaaaac
tctgtaaatctctcccccagcagtcactcgaacaacttgtcggtagtgacatacagtaag
ggtttccacggtccttatcccttcggacagtcttaa

DBGET integrated database retrieval system