KEGG   Gallus gallus (chicken): 419908Help
Entry
419908            CDS       T01006                                 

Gene name
IP6K3
Definition
(RefSeq) inositol hexakisphosphate kinase 3
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    419908 (IP6K3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     419908 (IP6K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 419908
NCBI-ProteinID: XP_418033
CGNC: 2080
Ensembl: ENSGALG00000026536
Position
26
AA seq 400 aa AA seqDB search
MVGQSEGKRAVLLEPFVHQVGGHMSMMKYDEHTVCKPLVSQELSFYESLPLAMRQFTPQY
KGVVSVHLKKDSFGNLTLLASPSLQPEGCGRLDNTSSDIWHKYKWAASASSSTELVKRCH
TQLTKTFKDSCPGRMRLRTDLQYCTDSLLEDANRNQTEKNSSNPWGLHCHRQHLNRMSSK
YNENKLHQFLLLENVVSKYNYPCILDLKMGTRQHGDDASEEKKARHIKKCEQSTSASLGV
RVCGMQVYQADAGHFLCKDKYYGRKLSPEGFRQTLQQFLCNGNHLRTDVLEPIILKLKAL
LSVIKKQSSYRFYSSSLLIIYDGLEHKEGTAPLDNHLQGHFQKTNCTTSHSRVDVRMIDF
AHTTFKGSKCNHTTYDGPDHGYIFGLENLIKILQNISEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggtggggcagagcgagggcaagagggcagtgctcctggagcccttcgtgcaccaggtg
ggcggccacatgagcatgatgaagtacgacgagcacacggtctgcaaacccctggtctcg
caggagctgagcttctacgagtcgctgcccctggccatgaggcagttcacccctcagtac
aaaggagtcgtttcagtgcacctcaagaaggacagctttggcaacctgaccctgctcgcc
agccccagcctacagcccgagggctgcggccgcctggacaacaccagcagtgacatatgg
cacaaatacaagtgggctgccagcgccagcagcagcactgagctcgtcaagaggtgccac
acgcagctcaccaagaccttcaaggacagctgcccgggcaggatgcgactgaggacagac
cttcagtactgcacagattcacttttggaagatgcaaacagaaaccagacagaaaaaaac
agctccaacccctggggactgcactgtcacagacagcacctgaaccgcatgtcctccaag
tataacgagaacaaactgcaccagtttctgttgcttgaaaacgtggtgtcgaaatacaac
tacccctgcatcctggacctaaagatgggaacccggcagcacggggacgatgcctcggag
gagaagaaagcacggcacatcaagaagtgtgaacaaagcacctccgcatcgctgggcgtc
cgcgtctgtgggatgcaggtttaccaagcggacgctggccattttctctgcaaggataaa
tattatggaaggaaactctcacccgagggattcaggcaaaccctgcagcagttcctgtgc
aacggtaaccatctcagaacggatgtgctggagcccatcatcctgaagctgaaagctctg
ctctccgtcattaagaagcaaagctcctacaggttctactccagctcccttctcatcatt
tacgacggactggagcacaaggagggcacggcccctttggataatcacctccaggggcac
ttccaaaaaacaaactgcaccacgtcgcactccagagtcgacgtccgcatgatagacttt
gctcacaccacctttaaaggctccaaatgcaatcacaccacttacgacgggccggaccac
ggctacatcttcggcttagagaacctcatcaaaatccttcagaacatttcggaaggaaaa
tga

DBGET integrated database retrieval system