KEGG   Gallus gallus (chicken): 419929
Entry
419929            CDS       T01006                                 

Symbol
TAF8
Name
(RefSeq) transcription initiation factor TFIID subunit 8
  KO
K14649  transcription initiation factor TFIID subunit 8
Organism
gga  Gallus gallus (chicken)
Pathway
gga03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    419929 (TAF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    419929 (TAF8)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     419929 (TAF8)
SSDB
Motif
Pfam: TAF8_C Bromo_TP
Other DBs
NCBI-GeneID: 419929
NCBI-ProteinID: NP_001026094
CGNC: 2552
Ensembl: ENSGALG00000003498
UniProt: Q5ZMS1
Position
26:5068715..5076380
AA seq 244 aa
MLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVETLPAYAKRSQRMVITAPP
VTNQPVTPKALTAGQNKPHPSHIPGYFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQR
RDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTVPYLTALLPSELEMQQMEETDSS
EQDDQTDTENLPLHISTDDSGPEKENASVLQQNTSLSGSRNGEENMIDNPYLRPVKKPKI
RRKK
NT seq 735 nt   +upstreamnt  +downstreamnt
atgttacagagctatatttctgaaattgggaggagtgcaaagtcctactgtgaacataca
gccagaacacagcctacactctctgatatagtggttactttagtggaaatggggttcaat
gttgaaacgcttcctgcatatgcaaagcgctcccagaggatggtcatcactgcccctcct
gtgacaaatcagcctgtgactcccaaggccctgacagctggacagaacaagccacatcca
tcccacatccctggctattttcccgagtttccagatcctcacacctacatcaagacacca
acataccgagagccagtgtctgattatcaagtcctgcgggaaaaggcagcatctcagagg
cgcgacgtggaaagagctctcacccgcttcatggctaagacaggagagacacagagtctc
ttcaaagatgatgttagcacattcccattgattgctgccaggcctttcactgtaccctac
ctgacagctcttctcccctctgagctggaaatgcagcaaatggaagaaacagattcatct
gagcaagacgaccagacagacacagagaacctgcccttgcatataagcacggatgattca
ggacctgaaaaagagaatgcttcagtattacagcagaacacctccttgtctggcagccgg
aatggggaggagaatatgatagacaatccttacctccggccggtgaaaaagcccaagatc
cgcagaaagaaatga

DBGET integrated database retrieval system