KEGG   Gallus gallus (chicken): 419932
Entry
419932            CDS       T01006                                 

Gene name
BTG2
Definition
(RefSeq) protein BTG2
  KO
K14443  protein Tob/BTG
Organism
gga  Gallus gallus (chicken)
Pathway
gga03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    419932 (BTG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    419932 (BTG2)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     419932 (BTG2)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     419932 (BTG2)
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 419932
NCBI-ProteinID: XP_418053
CGNC: 2580
Ensembl: ENSGALG00000026858
UniProt: A0A3Q3AWP4
Position
26
AA seq 164 aa
MSQRRGPPPRADMLPEIAAAVGFVSGLLRTRGCVSEQQLQVFSGALREALAEHYKHHWFP
EKPFKGSGYRCIRINHKMDPIISKAASQIGLSLPQLYQLLPSELTLWVDPYEVSYRIGED
GSICVLYEATAAKPVSSYGMLTCKNQMMIGRTSPSKNYIMTVSS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagccagcgccgtggaccccccccgcgggccgacatgctgcccgagatcgccgccgcc
gtcggtttcgtctccgggctgctgcggacgcggggctgcgtcagcgagcagcagctgcag
gtcttcagcggagcgttgcgggaggcgctcgcagagcactacaaacaccattggtttccc
gagaaaccattcaaaggctctgggtaccgctgcatccggatcaatcacaaaatggaccct
attatcagcaaggcagctagccagatcggactcagcctcccgcagctctaccagctcctg
cccagcgagctcacgctctgggtggacccctacgaggtctcataccgcattggtgaggac
ggctctatctgtgtcttgtatgaagcgacagcagccaagcctgtgagctcctatgggatg
cttacctgtaagaaccagatgatgataggtcgcaccagcccttcgaagaactacatcatg
actgtctccagctaa

DBGET integrated database retrieval system