KEGG   Gallus gallus (chicken): 419940
Entry
419940            CDS       T01006                                 

Gene name
CD79B
Definition
(RefSeq) B-cell antigen receptor complex-associated protein beta chain precursor
  KO
K06507  CD79B antigen
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    419940 (CD79B)
CD molecules [BR:gga04090]
 Proteins
  419940 (CD79B)
SSDB
Motif
Pfam: I-set V-set Ig_3 ig Ig_2 Ig_4
Other DBs
NCBI-GeneID: 419940
NCBI-ProteinID: NP_001006328
CGNC: 147
Ensembl: ENSGALG00000000251
UniProt: Q5ZLC0
Position
27
AA seq 226 aa
MGDFCRRLWVLQVNLWLMAAAAGGIPTDGNSTSNRTGSECVGMWQHPRYIAAKKNTSVHF
ICYTSQPHAMQWYKALGNGKEFHVLDQSSDRFSINNTNDRISFTISRISYEDNGIYVCDS
KNLTEEKRQPNSCGTEIRVMSRSNIQQIQNRNTLKDTIIIIQTILLVIFISVPMLLFLEK
GDRKERPEEDHTYEGLEVEQIATYEDITPFRDMKAKWTVGEHPGEE
NT seq 681 nt   +upstreamnt  +downstreamnt
atgggagatttctgcaggaggctgtgggtgctccaggtcaacctctggctgatggccgcg
gctgcaggtgggatcccaacagacgggaacagcaccagtaacagaacaggcagcgagtgc
gtcgggatgtggcagcacccacgctacattgctgccaagaagaacacatccgtccacttc
atctgctacaccagtcagccccacgccatgcagtggtacaaggcgctggggaatggaaag
gagttccacgtgctggatcagagctccgatcgcttcagcatcaataacacaaatgaccgc
atcagcttcaccatctccaggatcagctacgaggacaacggcatctacgtgtgcgacagc
aagaacctcacggaggagaagaggcagccaaactcatgtgggacggagatcagagtgatg
agtcgcagcaacatccagcagatccagaacaggaacacgctgaaggacaccatcatcatc
atccagaccatcctgctggtcatcttcatcagcgtccccatgctcctcttcctagaaaag
ggtgacagaaaggaaaggcctgaggaagaccacacctatgagggcctggaggtggagcag
attgccacctacgaggacatcactcctttccgggacatgaaggccaaatggacggtcggg
gagcacccaggagaggagtga

DBGET integrated database retrieval system