KEGG   Gallus gallus (chicken): 419955
Entry
419955            CDS       T01006                                 

Gene name
LIMD2
Definition
(RefSeq) LIM domain-containing protein 2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 419955
NCBI-ProteinID: NP_001006330
CGNC: 327
Ensembl: ENSGALG00000000529
Position
27
AA seq 128 aa
MFQASEAASTTPSHEAKSNSGGSTVQRSKSFSLKAQVKEMCTACQKTVYPMERLVADKFV
FHNSCFCCKHCHAKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWVHKE
VESGTKSA
NT seq 387 nt   +upstreamnt  +downstreamnt
atgttccaggcctcggaagccgccagcacaaccccgtcccacgaggcaaagagcaactca
ggaggcagcacagtgcagcgctccaagtccttcagcctgaaggcccaagtgaaggagatg
tgcaccgcctgccagaaaaccgtctatcccatggagcggctggtggcggataaattcgtc
ttccacaactcttgcttctgctgcaagcactgccacgccaagctcagcctgggcagctac
gcggctctccacggggagttctactgcaagccgcacttccagcagctcttcaagagtaaa
ggcaactacgacgagggctttgggcgcaagcagcacaaggagctgtgggtgcacaaggaa
gtggagagcgggaccaagtcggcatga

DBGET integrated database retrieval system