KEGG   Gallus gallus (chicken): 419995
Entry
419995            CDS       T01006                                 

Gene name
MLLT6
Definition
(RefSeq) protein AF-17 isoform X4
  KO
K23588  protein AF-17/10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    419995 (MLLT6)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     419995 (MLLT6)
SSDB
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2 HALZ
Other DBs
NCBI-GeneID: 419995
NCBI-ProteinID: XP_015154985
CGNC: 1092
Ensembl: ENSGALG00000034693
Position
27
AA seq 965 aa
MEPIVLQYVPHDRFNKTCYICEEQGRESKAASGACMACNRHGCRQAFHVTCAQMAGLLCE
EEVLEVDNVKYCGYCKYHFNKMKTSRHSAGSSFIAGRRSRSTSPTQEKHVSHHDRPKKSR
KDKERPKQKHKKRPESPTSLPTPTVPIAAEKGSTSHHEGSKETSEVGRSEVKGKKSSSHG
SSHKGKKTGSGKSSAGFSSASSSSAFQPAGTSCSSLQCSQDFVAFPKLEQDDEKYRKPVS
SSSSSHCSPLYEGQKGDIFEQKVIFSGFGSIMRFSTSAVSQPRGRDASPVDYKASNPISG
PSATGSVASSSSHKRMPSLSMEEGEVLKEKKHKGSKKNKHGPGRPKGGKSKEMLGAQLAG
STSTSSSPFSGGSLVSSSISNSSRPFSHTGNLPSLSMESPLLSSGIYTSNKDPISHGGGV
LRAVCSTPLSSSLLAHQGTASIPPLNRSPFASTIPTSSSSSVSTTQVFSLAGSTFSLPSS
HIFGSPLTSGLSINPLLNQSESSRAEPDLEDCSFGCRGTSPQESLSSMSPISSLPTLFDQ
TVSCSSSGQLENVPQATPNIEQLLEKQGNGEAGVNIVEMLKALHSLQKENQRLQEQIMTL
TAKKERLQLLNVQLSVPFPVVTSSNGPGSQAHYILPTNVCNNDSLSISKSPPCKNSFGIE
NSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPMLQQSPASLPLPGVQQVNGLARVAGSGL
GGGTTASHSLSTVPMVDGLMGTVAGGQQMPINGILGNLNGAQAAQPPSALTQASGPPTLQ
LSTSLSSMPSLSPLTEQQRHVLHQHEQQLQQLQQLLTSQPLNPEQQALVFQMMQQIQQKR
ELQRLQMTSSSQLSMSSLLAATSTPLLHSSTSAPMTSAPQPPPNSSSLMASLSPQQLNPS
NALLAPPQATPPLSAPGSSLMASGTGIPPVLTAQTNPFLNLQADGNTPKGTSMNEKGAPL
TQDKG
NT seq 2898 nt   +upstreamnt  +downstreamnt
atggagcccatcgtcctgcagtacgttccgcacgaccgcttcaacaagacctgctacatc
tgcgaggagcagggcagggagagcaaagcagcctctggagcgtgcatggcgtgcaaccgg
cacggctgccggcaagctttccacgtcacctgtgcccagatggccggcctcctgtgtgag
gaggaagtcctggaagttgacaatgtcaagtattgcggctactgcaagtaccacttcaat
aagatgaagacctcacggcactctgcaggcagctccttcattgctgggaggaggagtcgc
tccacgtcccccacccaggagaagcacgtgtcccaccacgacaggccaaagaagagtcgt
aaggacaaagaaagacctaaacagaagcacaaaaaacgtccggaatctcccaccagcctt
ccaacacccacggtgcccatcgctgcagaaaagggctccaccagccaccatgaggggagc
aaagagacctcagaggtcggcagatcagaggtgaaaggcaagaagtcctcgagccatggc
agcagccacaaggggaagaagactggaagcgggaagagctcggctgggttcagctcagca
tcctccagcagcgccttccagcctgcaggcacctcctgcagctccttgcagtgctcccag
gatttcgtggcgttccccaagctagagcaggacgacgagaagtaccgcaagcccgtctcc
tcctcttcatcctcccactgctccccgctgtacgaaggccagaagggggacatctttgag
cagaaggtgatcttctcaggcttcgggtccatcatgcgcttctccacctccgctgtgagc
cagccgaggggccgcgatgcttcccccgtggactacaaagcctccaaccccatcagtggc
ccttcggcgacgggcagcgttgccagcagcagcagccacaagcgtatgccatccctcagc
atggaggagggagaggtgctgaaggaaaagaagcacaaaggcagcaagaaaaacaagcac
gggcccggcaggccgaaagggggcaaaagcaaagagatgttgggtgcccagctggctggg
tccacgtcgacgtcctcgtcaccgttctccgggggttctcttgtcagctccagcatcagc
aactcttcgcggcccttcagccacacggggaacctgcccagcctcagcatggagtccccg
ctgctgagttcagggatctacaccagtaacaaggaccctatttcccacgggggcggagtg
ctccgggctgtgtgcagcacacccctctcctccagcctgctggcacaccagggcacagcg
tccatcccaccgctcaaccgctctccttttgcaagcaccatccccacctcctcctcctcc
tccgtctccaccacgcaggtgttctcgctggcaggttccaccttcagcctcccctcctcc
cacatctttggaagccccctcacatctgggctgtccatcaacccgctcttaaatcagtcg
gaaagcagccgggcagagcccgacctggaggactgcagtttcggctgccgagggacttcg
ccccaggagagtctctcttccatgtcccccatcagcagcctgccgaccctctttgaccag
acggtgtcctgcagcagcagcgggcagctggagaatgtcccccaggccacccccaacatc
gagcagctgctggagaagcagggcaacggggaagctggcgtcaacattgtagagatgctc
aaagctctgcactcgctgcagaaggagaaccagaggctccaggagcagatcatgacgctg
acggccaagaaggagcgtttgcagctcctcaacgtccagctctccgtccctttcccagtg
gtgaccagcagcaacgggccgggcagccaagcccactacatcctgcccaccaacgtgtgc
aacaacgattccctgagcatcagcaagagccccccgtgcaagaacagctttgggatcgag
aactcgctctccacttcctccgaggaccctcattcaggttgccccagcaggagcagctcc
tccctgtccttccacagcactcctccgcccctgcccatgctgcagcagagtcctgcctcg
ctaccccttcccggggtgcagcaggtgaatggcctggccagggtggcaggcagcgggctg
gggggtggcaccactgccagccacagcctctccacggtgcccatggtggacggcctgatg
gggaccgtggcaggaggtcagcagatgcccatcaacgggatcctggggaatctgaacgga
gctcaggccgcccagcctccaagcgcgctgacgcaggcgagcggccctccgaccttgcag
ctctccaccagcctgagcagcatgccgagcctgagtcccctgacggagcagcagcggcac
gtcttgcaccaacacgagcagcagctccagcagctccagcagctcctgacttctcaaccg
cttaatccggagcagcaggccctggtgttccagatgatgcagcagatccagcagaagagg
gagctgcagcggctgcagatgacgagctcatcccagctgtccatgagcagcctcctggca
gccacctccacccccctcctgcactccagcaccagcgccccgatgacctcggccccccag
ccgccccccaacagcagctccctcatggcctccctctccccccagcagctcaaccctagc
aatgccctcctggctccaccacaggccaccccaccgctcagcgctcctgggagcagcctc
atggcttcggggacaggcatccctcccgtcctcacagcacagactaacccgtttctcaac
ctgcaggctgatggcaacaccccgaaaggaacgagcatgaatgaaaagggagctcctctt
acccaagacaagggctaa

DBGET integrated database retrieval system