KEGG   Gallus gallus (chicken): 420027Help
Entry
420027            CDS       T01006                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04217  Necroptosis
gga04920  Adipocytokine signaling pathway
gga04933  AGE-RAGE signaling pathway in diabetic complications
Module
gga_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    420027 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    420027 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    420027 (STAT3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    420027 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    420027 (STAT3)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    420027 (STAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N Fib_alpha Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 420027
NCBI-ProteinID: NP_001026102
CGNC: 2374
Ensembl: ENSGALG00000003267
UniProt: Q6DV79
Position
27
AA seq 771 aa AA seqDB search
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMELTQECASSPM
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtggaaccaactgcagcagctcgacacgcggtacctggagcagctccaccag
ctttacagcgacagcttccccatggagctgcggcagttcctggccccgtggattgagagc
caggactgggcatacgctgccaacaaggagtcgcatgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgcttcctgcaggaatccaatgtcttgtaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatatttggagaagccgatggaa
atagcccgcattgtggctcgctgcctgtgggaagagtcacggctcctccagacagctgcc
actgcagcccagcaagggggacaggcgacacatccaacagcagctgtagtgacagaaaag
cagcagatgctggaacagcatctgcaggatgtaaggaagagagtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtcagtgacacgtcagaaaatg
cagcagttggaacagatgctcacagcactggaccagatgcgaaggggtattgtgagtgag
ctggcaggactgctgtcagccatggagtatgtgcagaagatgttggcagatgaggagttg
gcagactggaagagacggcaacaaattgcctgcattggtggcccaccaaatatctgctta
gaccggcttgagaactggataacctctcttgccgaatcacaactacagactcggcagcag
atcaagaagctggaggagctgcagcagaaggtgtcctacaagggtgacccaattgtccaa
caccggcccatgctggaggagcggatcgtggagctgttcaggaacctgatgaaaagtgct
ttcgtggtggagaggcagccctgcatgcccatgcatcctgaccggcctctggtcatcaaa
accggcgtgcagttcaccaccaaagtcagattgttggtgaagtttccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggtgatgttgcagcacttcggggg
tcccggaagtttaacatcctggggacaaacaccaaggtcatgaacatggaggagtcaaac
aacggcagcctttcagcagagttcaagcacctgacactgcgggaacagcggtgcggtaat
ggaggcagagccaactgtgatgcctcactgattgtgactgaggagctgcatctcatcacc
tttgagactgaggtgtaccaccaggggctgaagatcgatctggagacccactcactgcct
gtggttgtcatctcgaacatctgccagatgcctaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccacccattgggacg
tgggaccaggtggcagaggtgctgagctggcagttctcctctaccacaaagcgtggtctc
agcattgagcagctgacaaccctggcagaaaaacttttagggccaggtgtgaactactcg
ggctgtcagatcacctgggccaagttctgcaaggagaacatggcaggcaaaggcttctct
ttctgggtctggctggacaatatcattgacttggtgaaaaaatacatcctggctctgtgg
aatgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcccccaggaaccttcctcctgcgcttcagcgagagcagcaaggagggtggcatcacc
ttcacgtgggtggagaaggacatcagtggaaagactcagatccagtctgtggaaccttac
accaaacagcagctgaacagcatgtcgtttgcggaaatcatcatgggctacaaaatcatg
gatgccaccaacattctggtgtctcccctggtgtacctgtacccagacatcccaaaagag
gaggcatttgggaagtactgccgctctgagagccaggaacactcagaagctactgactca
ggtagtgctgctccgtatctgaagacaaagttcatctgtgtcacccccacctccttcagc
aataccattgacctgcccatgtccccgcgcacccttgactcactcatgcagtttggcaac
agtagcgagggagcagaggccaatgcaggaggccagttcgagtcgctgaccttcgacatg
gagctgacccaggagtgtgcttcctcaccaatgtga

DBGET integrated database retrieval system