KEGG   Gallus gallus (chicken): 420041
Entry
420041            CDS       T01006                                 

Gene name
KRT9L
Definition
(RefSeq) keratin, type I cytoskeletal 19 isoform X2
  KO
K07604  type I keratin, acidic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    420041 (KRT9L)
   04147 Exosome [BR:gga04147]
    420041 (KRT9L)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     420041 (KRT9L)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   420041 (KRT9L)
  Exosomal proteins of other body fluids (saliva and urine)
   420041 (KRT9L)
  Exosomal proteins of colorectal cancer cells
   420041 (KRT9L)
  Exosomal proteins of melanoma cells
   420041 (KRT9L)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Lebercilin DUF2017 DUF573 Vps5 Phage_GPO ADIP
Other DBs
NCBI-GeneID: 420041
NCBI-ProteinID: XP_004948660
CGNC: 51162
Ensembl: ENSGALG00000036846
Position
27
AA seq 555 aa
MSCSRSSSSCLRGGSGGSQHGSASAHRYTASRAGGRPAGGSCSGGSSRSSCGATGFGRMR
RSSYGGGMSSGMGGSSYAGGWSAGTYGGTMRCGGMGGGFGAGGSGFGAGYGGGFGSGSAG
FSAGSFGGGGFGGENMGILSNNEKLTMQNLNDRLASYLDKVRSLERENARLEQLIREWYQ
KQGPTGRKDYSHYYTTIEDLQNQILTAAVETNKILLDLDNTRMTAEDFRTKYETEYGLRQ
NVEADINTLRPLLDSLTLSRTDLEMQFESLKEEMINLKKDHEEDMKSLQTQSSGDVNVEV
NAAPGEDLLKKLNDMRQEYEQIIQKNREEVESWYESKMEEVSQQVHSSGQELESSNQQIS
VLRRDYQSLEIELQSELSRVGALQSNLEDTERRYNMQLQQIQGMIGPLEEELASIRCEME
SQNEEYKMLLGIKTRLEQEIAQYRALLNEGQHGISTSQGGAGGGSSGGHGHGGTSGSSAQ
GGSGGGSSWCSRGRSSGGSGGKTSGGGGGGCGKASGGGGGSGGGEGGKGCLSRSSSSHSQ
SGSCESPGSFRRSEH
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgagctgctcccggagctcttccagctgcctgcgagggggcagcggcggcagccagcac
ggctctgcatcagcacacagatacaccgcgtccagggcaggcgggcggcccgctgggggc
agctgcagcgggggcagctccaggagcagctgtggggcgacgggctttgggcggatgagg
cgcagcagctacggaggagggatgagcagcggaatggggggcagctcctatgccggggga
tggagtgcaggcacctacggagggacgatgcgctgcggcggcatgggaggtggctttgga
gcaggagggagcgggtttggcgcggggtatggagggggctttggctcgggcagtgctggg
ttcagtgctggcagctttggtggcggtggctttggtggagagaacatgggaattctgtcc
aacaatgaaaagctgaccatgcagaaccttaacgaccgcctggcttcgtacctggacaag
gtcagaagtctggaaagagaaaatgctcggctcgaacaattgatcagggagtggtaccag
aagcaaggtcctacaggaagaaaggactacagccactactacaccacaattgaagacctt
caaaatcagattctgactgcggctgtggagaccaacaaaattcttttggatctggataac
acaaggatgactgcagaagacttcaggacaaagtatgagaccgagtacggactgcggcag
aatgtggaggccgacatcaacaccctgcggcctctgctggacagcctgactctgagcagg
actgacctagaaatgcaatttgagtccctaaaagaagagatgattaacctcaagaaggac
cacgaggaggacatgaaatcactgcaaacacagtccagtggtgatgtgaatgtggaggtc
aatgctgctccaggagaggatctgctgaaaaaactgaatgatatgagacaagaatatgaa
caaattatccagaaaaaccgtgaagaggttgaaagttggtatgagagcaagatggaggag
gtgagccaacaagtccactcaagtggtcaggaactggaatcaagcaaccaacagatctct
gtgctgagacgtgactatcagagcctggaaattgagctgcagtctgagctcagcagggta
ggggctttgcagtccaacctggaggacacagaacgccgctacaacatgcagctgcagcag
atccagggcatgattggccccttggaggaggagctggccagcatccgctgcgagatggag
agccagaatgaggagtacaagatgctgctgggcatcaagacccgcctggagcaggagatt
gctcagtaccgggcactgctcaatgagggacagcatggtattagcacctcgcagggagga
gctggtggtggatcttctggaggtcacggacacggaggaacgagtgggtcttctgcacaa
ggtggaagtggaggaggaagcagctggtgctcacgtggaagaagcagcggaggatctggt
ggaaaaacttctggaggtggaggcggaggctgtggaaaagcttcaggcggaggagggggc
agtggtgggggagaagggggcaaaggctgcctctcccgctcatcatcctcccactcccag
tctggctcgtgtgaaagcccagggagtttcaggaggtctgagcactga

DBGET integrated database retrieval system