KEGG   Gallus gallus (chicken): 420045Help
Entry
420045            CDS       T01006                                 

Gene name
KRT20
Definition
(RefSeq) keratin, type I cytoskeletal 20
  KO
K07604  type I keratin, acidic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    420045 (KRT20)
   04147 Exosome [BR:gga04147]
    420045 (KRT20)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     420045 (KRT20)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   420045 (KRT20)
  Exosomal proteins of other body fluids (saliva and urine)
   420045 (KRT20)
  Exosomal proteins of colorectal cancer cells
   420045 (KRT20)
  Exosomal proteins of melanoma cells
   420045 (KRT20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 DUF573 YbjQ_1
Motif
Other DBs
NCBI-GeneID: 420045
NCBI-ProteinID: NP_001264910
CGNC: 13959
Ensembl: ENSGALG00000019716
Position
27
AA seq 436 aa AA seqDB search
MSFSTQSSQLGTAAHLQGTAPGGSALSVRSAAVQRIQAPSVYGGAGGYGTRISSSSVRRQ
SSSGAFHSNISDNDLLLSGNEKSTMQNLNDRLAAYLERVRSLEKANSLLEKQIKEWHEKN
TVGVRSDYSSYFQTIEDLQSKIGAAQLENAKLVLQIDNAKLAADDFRLKYENELLLRQSV
ESDINGLLRVLDDLTLTKSDLESQIENVNEEIVFLKKNHEEEVDRLRKQVGGSVNVEVDA
APGTDLASIMENMRRQYEEMAEKNRQEAKERFEKQTEALNQEVAINVEQLQEQRREVTDR
RQICQSLELELQTHLNMKKPLEDTLAETEARYSFQLAQIQETIAKLEAQLRQLRADMEAQ
NTEYSVLLDIKTRLELEIATYRRLLEGEDVGLVQEDAVTTELEKESSKIKKIKTIVEEVI
DGKVVSSQVKEIEEKM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcattctctacacaaagctcccagctgggcacggctgcccacttgcagggcacagct
cctggtggcagcgctctgtccgtcaggagcgcggccgtgcagcggatccaggcacccagc
gtctatggcggggcgggcggctatggcacccgcatctccagcagcagcgtccgcaggcag
agctccagcggcgccttccactccaacatctctgacaacgatctactgctctctggtaat
gagaaatcaaccatgcaaaatctaaatgaccgtttggctgcctatctggagagggtgcgc
tctctggagaaagcaaactccctgcttgaaaagcagatcaaggagtggcatgagaagaat
acagtaggcgtaaggagtgactacagctcatacttccaaacaatcgaggatcttcaaagc
aagattggtgctgcacagttggaaaatgcaaagcttgtcctgcagatcgacaacgccaag
ctggctgctgatgatttcaggctgaagtatgaaaacgagctcttgctcaggcaaagtgtt
gagagtgacatcaatgggctgctgcgagtccttgacgacctgactttaaccaaatcagac
ttggagtcgcagattgaaaacgtgaatgaagaaatagtttttcttaagaagaaccatgag
gaggaggttgacagactgcgcaaacaagtgggcggctcggttaacgtagaggtggatgct
gctccaggtactgatcttgcaagtattatggagaacatgagacggcagtatgaagaaatg
gcagaaaagaaccgccaagaagccaaagaaagatttgaaaagcaaacagaagcgctgaac
caggaagtagcaatcaatgtagaacagctgcaagaacaaaggagagaggtgacagatcgg
agacagatctgccagagcctggagctggaattacagacccatctcaacatgaagaagcct
ttggaagacactctggctgaaaccgaagcacgttacagttttcagttggctcaaatacag
gaaacaattgccaagttagaggctcagctgaggcaactgcgggctgacatggaggcacag
aacacagagtacagcgtcctgctggatatcaagactcgcctggaactggagatcgccaca
taccgacgtctgctggaaggagaggacgtcgggttagtccaagaggatgcagtgacaact
gaacttgaaaaagaatcaagtaaaattaaaaagatcaagacaattgtcgaagaggtgatt
gacggcaaagtcgtgtcctctcaggttaaggagattgaggagaagatgtga

DBGET integrated database retrieval system