KEGG   Gallus gallus (chicken): 420078
Entry
420078            CDS       T01006                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  [histone H3]-lysine79 N-trimethyltransferase [EC:2.1.1.360]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    420078 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    420078 (DOT1L)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.360  [histone H3]-lysine79 N-trimethyltransferase
     420078 (DOT1L)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     420078 (DOT1L)
   HMT complexes
    Dot1-containing complex
     420078 (DOT1L)
SSDB
Motif
Pfam: DOT1
Other DBs
NCBI-GeneID: 420078
NCBI-ProteinID: XP_015155350
CGNC: 549
Ensembl: ENSGALG00000000843
Position
28
AA seq 1734 aa
MGERLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVQ
ENKDSGAEEEKAGANAVKKPSPSKARKKKLSKKGRKMAGRKRGRPKKMNTANTERKTKKN
QTALELLHAQTVSQTSSSSPQDAYKSPHSPYYQLPPKVQRHSSNQLLVTPTPPALQKLLD
SFKIQYMQFMAYMKTPQYKASLQQLLEQEKEKNAQLLGTAQQLFTHCQAQKEEIKRLFQQ
KLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKL
DWSTLSLENLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELMQLKSYTPSDESL
SVQLRNKTHLSRDAEADHGRFQLELECSKFPMPHVNGLSPELSMNGHATPYEIHNTFSRP
SSKQNTPQYMTSHLDQEIVPCTPNHSRQKADRMASLSLPDYTRFSPAKIALRRHLNQDHT
VNGKATTSEIQRADHVKENGLTYPSPSISNGIKLSPQETRPSSPAALPIAGEKVLRERTS
VSNGETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQSRDSSTLEK
QIGASSHNGVSNAAGNKPLALATSGFSYSSGSVAVNGNLTNSPAHLNHSVDQAALDDSGS
LFNSVGSRSSTPQHPLLMMQSRNSGQSSPAHQHSASPRLNGTSQSLVGGLHYADAQKMFA
EGTKGDLQSDAAFSDPENEAKRRIIFTISPNTGHVKQSPSTKHSPLPASARLDCGPAHGQ
DGKKRGRRKRSSTGNLSGGSGVSPKRKSLPAVSGLFTQPSGSPLNINSMVNNINQPLEIT
AISSPENSLKNSPVPYQDNDQPPVLKKEKPLTQSNGVHYSPLTSDDEQGSEDEHNSTRIE
RKIATISLESKSPQKTVENGGSLSGRKQAQPNENMNSSKWKSTFSPISDINLTKTTDSPL
QSVSSLSQNSLFAFRPSSEDSLAMDAKMAHARKGMAMPSSGADGLSPSTNPTNGFAYNGG
LSTDIGLHSFIDGASLPHKASDGTAAACSLGFQSQRSKDVGISETNPFLNKRQLEGLGGA
KGEDLSRAGVKSKDMSEMSIRAGGSSEKNSLQHNGKVGKGRDRDVEFKNGHNLFISAAVS
SGGLLNGKSLSTAVSSAGNPASSVQTHHPFLNTLTTGSQFPLGPMALQANLNSVTNSSVL
QSLFNSMPAAASLVHVSSAATRLTNSHTMGNFSPGVTGGTVGGIFNHAVPSASSPHQFGA
SFSSSAVSSSTVLSLNPLQAVASTSSSSFPPPSSNLVTSSENRAAQHLNRAPVQSVFHPP
PPPPNVSLPPPPPLLASNPDLLHSPSIPPGDAFLPSSSAASVHSNTALSIKLASLQHKAS
RPSFTVHHPPLPRSALAQSVPPMAQPTAAGAPAMWVTLGMQPPSASHLSGVKPR
NT seq 5205 nt   +upstreamnt  +downstreamnt
atgggcgagcggctggagctgcgcctcaagtcgccggtgggagccgagcccgccgtgtac
ccgtggccgctgcccgtctacgacaaacaccatgatgctgctcatgaaatcattgagaca
attcggtgggtctgtgaagaaatcccagatctcaagcttgctatggaaaactacgttcta
attgactatgacacaaaaagctttgaaagcatgcagcggctgtgtgacaagtacaaccgc
gccatcgacagcatccatcagctgtggaagggaaccacccaaccgatgaagctgaacact
cgtccctccaacgggctcctccggcacatcctgcagcaggtttacaaccactcggtgacc
gaccccgagaaactcaacaactacgagcccttctcccctgaggtgtatggagaaacctcc
ttcgacctggtggcccagatgatagatgagattaaaatgacagaggacgacctctttgtc
gacttgggcagcggtgtgggtcaggtggtgcttcaagtggccgcagccacgaactgcaaa
catcactatggtgtggagaaagctgacattccagccaaatacgctgagacgatggacaga
gagttcagaaagtggatgaaatggtatgggaaaaaacatgcagaatacacactggaaaga
ggtgacttcctctcagaagaatggagagagagaattgcaaacacaagtgttatttttgtg
aataattttgcctttggtcctgaggtggatcaccaactgaaggagcgatttgccaacatg
aaggaaggtgggagaattgtgtcctcaaaaccttttgcacctctgaatttcagaattaac
agtcgaaacttgagtgatattggcactataatgagagtcgtggagctgtcaccactgaaa
ggctctgtgtcgtggactgggaagccagtctcttactacctgcatactattgaccgaacc
atacttgaaaactatttttctagtctcaaaaatccaaaactcagggaggaacaagaggca
gctagacgtcgtcagcagcgagaaaacaagagcaacacgactactccaacgaaggttcaa
gaaaacaaggattctggtgctgaagaagaaaaagctggggcaaatgctgttaaaaagcca
tctccctctaaagcaaggaagaaaaaactgagcaaaaaaggaaggaaaatggcaggcagg
aagcgagggcgtcccaagaaaatgaacactgcaaatacggagcgcaagaccaagaagaac
caaactgcactagaacttctgcatgctcaaactgtgtcacagacatcttcatcctctcct
caggatgcatacaagtcacctcatagtccatattaccaactacctcctaaagtgcaacgg
cattcatccaaccagctgctggtgacacccaccccacctgcactacagaagctgctagac
tcttttaagatccagtacatgcagttcatggcgtacatgaaaactcctcaatataaagca
agtctgcaacagttgctggagcaggagaaggagaagaatgcacagctactggggacggcg
cagcagttgttcacccactgccaggcacagaaagaggaaatcaaacgtctttttcagcag
aaactcgatgagttgggagtgaaggctctgacatacaacgacctgattcaggctcagaag
gaaatctctgctcacaatcagcagctgaaagaacagaccaaacagctggagaaggataac
agcgaactcaggaaccagagcctgcagctgctgaaggcacgctgcgaagagctgaagcta
gattggtccacgctgtcactggagaacttgctgaaggagaagcaggctctgaagaatcag
atttctgagaaacaaaagcactgtttggaactgcagatcagcattgtggaacttgagaaa
agccaaaggcagcaggagctcatgcagctgaaatcgtacacgccgtcggatgagtcactg
tcagtgcagctacggaataaaacccacctgagccgcgatgctgaggctgatcatggcagg
ttccagctggagctcgagtgctccaagtttcctatgccccacgtcaatggcttgagcccc
gaactgtccatgaatggccacgctactccctatgagattcacaacactttcagcaggccg
tcctccaagcagaacacccctcagtacatgacctctcatctggaccaagaaatagttcca
tgtaccccaaaccacagcaggcagaaggcggacaggatggcgagcctgtccttacctgat
tataccaggttttcccctgcgaaaatagcactaaggagacacttgaatcaagaccacaca
gtcaatggaaaagcaacaacgagtgagatacagagagctgaccacgtcaaagagaacggc
cttacatatccaagccccagtatttccaatggcatcaagctgagtcctcaggaaactcgg
ccctcttccccagcggccttaccgattgcaggcgagaaggttttgagagagagaacctct
gtgagtaatggagaaactatcaccagcctacccatcagtattcctctcagcacagtgcag
cccaataagctccctgttagcatccctctggccagcgtagttctgcctagccgtgttgag
aaggtgagaagcacacctagcccagttcatcagagcagagactcatcgacacttgaaaag
cagattggtgctagttctcataatggtgtaagcaatgctgctggaaacaagccactggct
ttggctacctcaggtttttcttactcttctggctccgtggcagtcaatggaaatcttaca
aacagcccagcccatcttaaccatagtgttgatcaggcagctctggacgactctgggagt
ctgtttaactcagtagggtctcggagttccactccacaacatcctttgctaatgatgcag
tcgaggaactctgggcaaagctcccctgctcaccagcactcagcaagccccaggttaaat
ggcacctcccagagcctggtagggggactgcactatgcagatgctcagaagatgtttgcc
gaaggaacaaagggggatcttcagtctgatgcagcattttcagatcctgagaacgaggcc
aagagaagaatcatctttacaatctctcctaatacaggacatgtaaaacaatccccttcc
accaagcacagccctctgcccgcgagcgctcggctggactgcggcccagcacacgggcag
gacgggaagaagcgcggccggcggaagagatcctccactgggaacctcagcgggggctcc
ggggtctcccccaaacgcaaatccttgcccgctgtgtccggactctttacgcagccatca
ggttcaccgctcaatatcaactccatggtcaataacattaaccagcctttagaaataaca
gccatttcctctcctgaaaactccctgaagaactctcctgttccttaccaggacaacgac
cagcccccggtactgaaaaaggaaaagcccctcactcagagcaacggcgttcattactcc
cctctcacgtcagatgacgagcagggatctgaagatgagcacaacagcaccaggatcgag
aggaaaattgcaacgatatcgctggaaagcaaatctccacagaagactgttgaaaatggt
ggcagcttatctgggaggaaacaagcacaacccaacgagaacatgaacagcagcaaatgg
aaatctactttctcaccaatatctgacatcaacctgaccaaaaccacggacagtcccttg
cagtctgtgtcgtctctgagccagaattcgctgtttgccttcaggccgtcctctgaggac
agcctcgccatggatgccaagatggcacacgcaaggaaaggcatggccatgccctcgtcg
ggggcagacgggctcagccccagcacaaaccccaccaacgggttcgcctacaacggtggg
ctgtcgactgacattggtttacacagctttatcgatggtgcttctcttccacacaaggcc
tcggacgggacggccgctgcctgctctctggggttccagtcgcagcggagcaaagatgtg
gggatatcggaaacaaaccctttcttgaacaagaggcaactcgaaggcctcggcggcgcc
aagggagaagacctcagccgggcaggagtcaaaagcaaagacatgagtgaaatgagcatt
cgtgcggggggttcttcagagaaaaactctttgcagcataacggaaaggtcggcaaagga
agggaccgagatgtggagttcaaaaacggccataaccttttcatttctgctgctgtttca
tctggtggccttctgaatgggaaaagcctttctactgctgtttcttcagcaggcaaccca
gcatcgtctgtgcagacgcaccatcccttcctcaacactttgaccactggatcgcagttc
cccctcggccccatggccttgcaagccaacctcaactcggtgacaaactcctcagtattg
cagtccttatttaattccatgccagctgctgccagtctggtccacgtgtcgtcagctgca
accagactgactaattctcacactatggggaacttctctcctggggttacaggtggaaca
gttggaggtatttttaaccatgcggtgccttctgcctcctctcctcatcagtttggagcc
agtttcagcagcagtgctgtctctagcagcacagtgctaagcttaaaccccctgcaggct
gttgccagcacctcgtcctcatccttcccacccccctcctctaatttagtaacatctagc
gagaatagagccgctcagcacctcaacagagcgccagtgcaatctgttttccatcctcct
ccgccccctcctaacgtttccttgcccccacccccccctctgctcgcttctaaccccgac
ctcctgcacagcccatccatcccacccggcgacgctttcctgccatcctcttccgccgct
tctgtccactctaacaccgctttgtctatcaagctcgcttccctgcagcacaaagcctcc
cgcccctcctttaccgtccaccacccccccctgccccgctcggcgctggcacagtccgtg
cccccgatggcgcagcccacggccgccggcgcgcccgccatgtgggtcacgcttggcatg
cagcctccttccgcttcgcacctttctggggttaagccgcgataa

DBGET integrated database retrieval system