KEGG   Gallus gallus (chicken): 420089
Entry
420089            CDS       T01006                                 

Gene name
MLLT1
Definition
(RefSeq) protein ENL isoform X1
  KO
K15187  YEATS domain-containing protein 1/3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    420089 (MLLT1)
   03036 Chromosome and associated proteins [BR:gga03036]
    420089 (MLLT1)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     420089 (MLLT1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     420089 (MLLT1)
SSDB
Motif
Pfam: YEATS AHD BET
Other DBs
NCBI-GeneID: 420089
NCBI-ProteinID: XP_015155332
CGNC: 1107
Ensembl: ENSGALG00000001596
Position
28
AA seq 557 aa
MDNQCTVQVKLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFRLHESFP
KPKRVCKEPPYKVEESGYAGFIMPIEVYFRNKEEPKKVCFTYDLFLNLEGNPPVNHLRCE
KLTFNNPTKEFRRKLIKAGGVMVMPEGAETVSRPSPDYPMLPTIPLSAFSDPKKTKPSHG
SKDANKESSKASKPHKVTKEHRERPRKDSESKNSSKDLEREQNKPLKDSSRKPTENKLPK
EEKAPPKAAFKEPKLAVKETKLENTSPKGGPQPELKSSSKRPSNVESPKPSAKKQKKSSS
KGVKNILGTSPRTSSSSYPEKKQTKEKMNAKVEKVKSESEAKEIKKPVEMEESNSEDENS
FKSEGVKSVQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDDDDSSSGE
EAAVKANPVSRDSRLSLSDSDSDNSADSCLPSREPPSAQKLPPANNKASGRKSPESCNKP
EKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSL
DETTVRKLQSYLEAVAT
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggacaatcagtgcacagttcaagtcaaattggagctggggcaccgagcccagctgcgg
aagaagcccacgactgaggggttcacccatgactggatggtatttgtgcgtggcccggag
cagtgtgacatccagcacttcgtggagaaggtggtcttcaggctgcatgagagcttcccg
aaacccaagcgagtgtgcaaggagcccccgtacaaagtggaggagtctggctacgcaggc
ttcattatgcccattgaagtgtacttcagaaataaggaggagccgaaaaaggtttgtttc
acatacgacctgtttttaaacttggagggaaatccaccagtgaaccacctgcgttgtgag
aaactgactttcaacaaccccaccaaggaattcagacgcaaacttattaaggctggaggg
gtgatggtaatgccagagggagcagaaactgtttcaaggccaagtcccgattatcctatg
ttacccacaataccactctctgccttctctgatcccaagaagaccaagccatcccatggg
tcaaaggatgccaacaaggaaagcagcaaggcatccaagccgcacaaagtaaccaaggag
cacagagagaggccaaggaaagactctgagagcaaaaactcctccaaagaccttgaaaga
gaacaaaacaaacctttgaaggactcctccagaaaaccaacagagaacaaactgcctaag
gaggagaaggcgcctccgaaagctgctttcaaggaaccaaaactggccgtgaaggagacc
aaactggagaacacctctccgaagggtgggccgcagccggagttgaagtcttccagcaag
aggccctccaacgtggagtcaccaaagcccagtgccaaaaaacaaaaaaagagcagctcc
aaaggggtgaagaatatcctggggacatctcccagaacctcgtcttcctcatatccagag
aagaaacaaaccaaggagaagatgaatgccaaagtggaaaaggtaaaatctgaaagcgag
gccaaggagatcaaaaagcctgtggaaatggaggagtcaaattcagaggatgagaattct
ttcaaatcagagggggttaagtctgtccagtccagcccttccaactccagctccagctcc
gactccagctctgactccgactttgagccatctcagaaccacagtcaaggcccactgcgc
tccatggtggaggatctgcagtcggaggagtcggacgatgatgatagctcctcaggggaa
gaggcagcagtcaaagcaaaccctgtcagccgggattccagactgagccttagtgatagt
gacagtgacaacagtgctgactcctgcctgccgagtcgagagcctccctctgctcagaag
ctgcccccagcaaataataaggcatctggaagaaaaagcccagagtcttgtaataagcca
gagaagatcctgaagaagggaacctatgacaaggcctacactgatgaattagtggagctt
cacaggcgactcatggcactacgagagcgcaatgtgctgcagcagattgtaaatctcatt
gaggaaacggggcattttaacgttaccaacacaacctttgactttgacctcttctccctg
gatgaaacaactgttcgtaagctgcagagctacctggaagcagtagcaacatga

DBGET integrated database retrieval system