KEGG   Gallus gallus (chicken): 420133
Entry
420133            CDS       T01006                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04150  mTOR signaling pathway
gga04520  Adherens junction
gga04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    420133 (INSR)
   04068 FoxO signaling pathway
    420133 (INSR)
   04150 mTOR signaling pathway
    420133 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    420133 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    420133 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    420133 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    420133 (INSR)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     420133 (INSR)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   420133 (INSR)
CD molecules [BR:gga04090]
 Proteins
  420133 (INSR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Insulin_TMD Kinase-like B2
Other DBs
NCBI-GeneID: 420133
NCBI-ProteinID: XP_001233399
CGNC: 2614
Ensembl: ENSGALG00000040758
Position
28
AA seq 1353 aa
MGPRAAAAAVVAVAAVLAACGGRAEICRSMDIRNNLTRLSLLENCTVIEGHLQILLMFKT
KPEDFRELSFPKLTMITDYLLLFRVYGLESLKGLFPNLTVIRGTHLFFNYALVIFEMVHL
KEIGLYNLMNITRGAVRIEKNNELCYLSTIDWSRILDSVEDNYIIANKDDKEECGDVCPG
TVKGKSNCPPTVINGIFIERCWTHDRCQRVCPPACKSQGCTSDGQCCHSECLGDCTEPNN
AERCVACRNFYLDGTCVETCPPGHYRFEGWRCVTFSFCQELHNKCKSARESGCHVIHNNE
CVHECPSGYIMNSSNLHCTPCAGPCPKVCDYGKEKTIDSVTSAQELRGCTVVNGSLVINI
RGGNNIAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLHLIRGETLEAGNYSFYALD
NQNLRQLWDWSKHNLTIARGKLFFHYNPKLCLSEIHKMEEISGTKGRQERNDIALKTNGD
QASCENELLKFSSIRTSHDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDAC
GSNSWTVVDVDPPPRSNEPKAQAQPGWLLRGLKPWTQYAVFVKTLVTFSDERRTYGAKSE
IIYVQTNATVPSVPLDPISVSNSSSQIILKWKPPSEPNGNITHYLVYWQQQAEDSELYEL
DYCLKGLKLPSRTWSPPFESEDPQKYNQSESEDVSGECCSCPKTDSQIQKELEESAFRKT
FENYLHNEVFVPRPSRKRRDLGSIANATVVIPTIPSSPNSSAAASESAEEQKPFEKVKFK
ESLVISGLRHFTGYRIELHACNHDAQESRCSVAAYVSARTMPEAKADDIVGPVTHELVEK
NTVHLKWQEPKEPNGLIVLYEVNYGRLGEAEEAHFCVSRKHFASEQGCKLRGLQPGNYSV
RIRATSLAGNGSWTEPTYFYVADYLNAQPNIAVIIVPIIFAIIIAGIIGAAYVLVKKRQT
EGPTGPLYASSNPEYLSASDVYVPDEWEVPREKITLLRELGQGSFGMVYEGIAKDIVKGE
LETRVAVKTVNESASLRERIEFLNEASVMKGFSCHHVVRLLGVVSKGQPTLVVMELMAHG
DLKSYLRSLRPDAENNPGRPPPTLREMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAE
DFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTYSDVWSFGVVLWEI
SSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERLHNLMQMCWQYNPKMRPTFIEVIEM
LKEDLHPSFQEVSFFYSEENKPLETEEYEMDFENMESIPLDPSSYTQRDKALGRDNGPSM
ALKGNYEEHIPYTHMNGGKKNGRILSMPRSSPS
NT seq 4062 nt   +upstreamnt  +downstreamnt
atgggaccgagagcggcggcggcggcggtcgtggcggtggccgcggtgttggcggcctgc
ggcggccgcgccgagatttgcagaagcatggacatccgcaacaacctgacccggctgagc
ctgctggagaactgcacggtgattgagggccacctgcaaatactgctcatgttcaaaacc
aagcccgaagatttccgcgagctcagcttccccaaactgactatgattacagactatttg
ctcctgttccgtgtgtacggcctggagagcttaaagggcctcttccccaacctcacggtg
atccgaggaacccacctgttctttaactacgcgttggtcatctttgagatggttcacctg
aaggagatcggcctctacaacctgatgaacatcacgcgcggcgccgtgcgcatcgagaag
aacaacgagctgtgctacctgtccaccatcgactggtcgaggattttggactccgtcgag
gacaactacatcatcgccaacaaggatgacaaggaggagtgtggagatgtgtgtccagga
actgtgaaagggaaaagcaactgcccgcccaccgtcatcaacggtatcttcatcgagcgc
tgctggacccacgaccgctgccagagagtttgcccacccgcctgcaagtcccagggctgc
acgtcggacgggcagtgctgtcacagtgagtgcctcggggactgcacggagcccaacaac
gcggagcgctgcgtggcgtgccgcaacttctacctggacgggacgtgcgtggagacgtgc
ccacccgggcactaccgcttcgagggctggcgctgcgtcaccttcagcttctgccaggag
ctgcacaacaagtgcaagagcgcccgcgagtcgggctgccacgtcatccacaacaacgag
tgtgtccacgagtgcccatcggggtacatcatgaattccagcaatttgcactgcactccc
tgtgcagggccctgtccaaaggtttgtgactatgggaaagagaagactatcgattcggtg
acgtcggcacaggagctccgtggctgcacagttgttaatgggagcttggttataaatatc
cgtggaggaaataacatagcagctgagctggaagcgaatcttggcctgatagaagaaatc
tcaggttacctaaaaatccgccggtcgtatgccttggtttctctttcttttttccgtaaa
ctgcatctgatcagaggagaaacgttagaagctggaaattactcattttatgctttggac
aaccagaatcttcgccagctctgggactggagtaaacacaacctcacgatagcacgaggc
aaactcttcttccattacaatcccaaactgtgtttgtcagaaatccacaagatggaggag
atctctgggactaaggggcgtcaggagaggaacgacatagccctgaagacaaacggtgac
caagcctcatgtgaaaacgaattgctgaagttctcttccattagaacaagtcatgacaag
atcctgttgaagtgggagccctattggcctcctgatttccgtgacctcctgggatttatg
ctcttttacaaagaggctccataccaaaacgtgacggagtttgatgggcaggatgcctgc
ggctccaacagctggacggtcgtggatgtggacccaccaccgcggtccaacgagcccaaa
gcccaggcccagccaggctggctgctgcggggcctgaagccatggacacagtatgctgtg
tttgttaaaactctggtcaccttctcagatgaacgaaggacatacggtgcaaagagtgag
atcatctacgtccagaccaacgctacggttccgtcagtcccattagatccaatttctgtt
tccaactcttcatcccaaatcatcctgaagtggaagccgccctcggagcccaatggtaac
atcacgcactacctggtgtactggcagcagcaggcagaagacagtgagctttatgaactc
gattactgcttaaagggattaaaactgccctcgaggacgtggtctcctccttttgaatct
gaagaccctcagaagtacaaccaaagtgaaagtgaggacgtcagtggagagtgttgttcc
tgtcctaaaaccgactctcagatccagaaggagctggaggagtctgccttccgcaagacc
tttgagaactacctgcacaacgaggtgttcgtccccaggccatcaaggaagagaagagac
ctgggctccattgccaatgccaccgtggtgatccccaccatcccgtcctctccaaactct
tccgcagccgcatctgagagtgcagaggagcagaagccttttgaaaaagtgaagttcaag
gagtccctggtgatctccgggctgcggcacttcacggggtaccgcattgagctccacgcg
tgtaaccacgacgcgcaggaatcccggtgcagcgttgcagcttatgtcagtgccaggacc
atgccggaggctaaggcagatgacatcgttggtccagtcacccatgaactggttgaaaaa
aacactgtgcatttgaagtggcaggagcccaaggagccgaatggccttattgtgctgtac
gaagtgaattacggccgtctgggggaagcagaggaagcgcacttctgcgtgtcccgtaag
cactttgccagcgagcagggctgcaaactgcgcgggctgcagcccgggaactacagcgtg
cggatccgagcgacgtcgctggctgggaacggctcctggacagagcccacctacttctat
gtggctgattacttgaacgctcagcctaatattgctgttataattgttccgattattttt
gccataatcattgctggaattattggagctgcttacgtgctcgtgaaaaagagacaaact
gaaggaccaacggggccactctacgcatcctccaaccccgaatacctcagtgccagtgat
gtgtacgttcccgatgagtgggaggtgccacgggaaaagatcactctgctccgtgagctg
ggccagggctcatttgggatggtgtacgaggggatcgccaaggacatcgtgaagggagag
ctggagacccgcgtggctgtgaaaacggtgaacgaatcggccagcctgcgggagcgcatt
gagttcctcaatgaagcctccgtgatgaaaggcttcagctgccaccacgtggttcgcctc
ctcggggtggtctccaagggccaacccacactggtggtcatggagttaatggcacatgga
gacttgaaaagctacctacgctctctgagacccgacgctgagaataaccctggtcgtcca
ccaccaacactgagagaaatgatccagatggctgcagagatcgctgatggcatggcctat
ctgaatgccaagaagtttgttcacagagacctggcagctcggaactgcatggttgcagag
gacttcactgtaaagattggagacttcggcatgaccagagatatctacgagacggattat
taccgaaagggcggcaaaggacttctgcctgtgcggtggatggcgcctgaatcgctgaag
gatggcgtattcacaacgtactcagatgtgtggtcatttggtgttgtcctttgggagata
agcagcttagcagagcagccatatcagggactctccaacgaacaggtgctgaagtttgtg
atggatggaggatacctggatcagccggacaactgcccggagaggctgcacaacctgatg
cagatgtgctggcagtacaaccccaagatgcgccccaccttcattgaggtcattgagatg
ctgaaggaggatttgcaccccagcttccaggaggtttctttcttctacagcgaggagaac
aagcctctggaaacagaggagtatgagatggacttcgagaacatggagagcatccccctc
gatccctcctcgtacacacagagggacaaagccctggggcgggacaatgggccctccatg
gccctaaaggggaactatgaggagcacataccttacactcacatgaacggaggcaagaag
aacgggcggatcctctccatgcccaggtcaagtccttcctaa

DBGET integrated database retrieval system