KEGG   Gallus gallus (chicken): 420147
Entry
420147            CDS       T01006                                 

Gene name
EPS15L1
Definition
(RefSeq) epidermal growth factor receptor substrate 15-like 1 isoform X1
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    420147 (EPS15L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    420147 (EPS15L1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    420147 (EPS15L1)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    420147 (EPS15L1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 EF-hand domain-containing proteins
  EH (EPS15 homology) domain-containing proteins
   420147 (EPS15L1)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 Crescentin Macoilin EF-hand_7 EF-hand_8 EzrA EF-hand_5 CALCOCO1 BicD Spc7 Tropomyosin ERM zf-C4H2 DUF4201 LMBR1 Atg14 DUF4763 Fez1 ATG16
Other DBs
NCBI-GeneID: 420147
NCBI-ProteinID: XP_025000181
CGNC: 14640
Ensembl: ENSGALG00000003914 ENSGALG00000021601
Position
28
AA seq 932 aa
MAALIPLGQQFSAGIPLYETYYKQVDPTYTGRVGANEAALFLKKSGLSDIILGKIWDLAD
PEGKGYLDKQGFYVALRLVACAQNGHEVNLSSLNLTVPPPKFHDTSSPLLITPPSTETHW
AVRVEEKAKFDGIFESLLPVNGLLSGDKVKPVLMNSKLPLDILGRVWDLSDIDKDGHLDK
DEFAVAMHLVYRALEKEPVPSLLPPSLIPPSKRKKTPVFPGAVPVLPASPPPKDSLRSTP
SHGSVNSLNSTGSLSPKHSIKQAQPSVNWVVPMSEKVRYDDIFLKTDTDMDGFVSGQEVK
DIFMHSGLSQNLLAHIWALADTRQIGKLSKDQFALAMYLIQQKVSKGIDPPQVLSPDMIP
PTERNTPIQTLSGYLTPVGTEISALTEMRRDSSSSVGSGEFTGVKELDDISQEIAQLQRE
KYSLEQDIREKEDSIRQKTNEVQELQNDLDRETSNLQELEAQKQDAQDRLDEMDQQKAKL
KDMLNDVRQKCQEETQVISSLKMQIQSQESDLKSQEDDLNRAKAELNRLQQEETQLEQSI
QAGKVQLETIIKSLKSTQEEINQARSKLSQLQESHQEVNKSIEEYNEALNGVNGGSLTNL
ADISEGLGQTERSNYGAMDDPFKNKALMFTNNTQELHTDPFQSEDPFKSDPFKGADPFKG
SDPFQHDPFAEQPPAPADPFGGDPFKESDPFRSSAPEDFFKKQVKSDPFTSDPFTKPSTL
PSKPDPFESSDPFTSSSVSSKGPDPFGTLDPFGSGAFSSSEGFADFSQMSKSVASDPFTS
SFGGMGFSDDPFKSKSDTPALPPKKNVPPRPKPPSGKSTPVSHLGPSDFPKPHDPFQPFG
ADSSDPFQSKKGFGDPFSGKDPFAPSSSSKTSKDSSLGFADFSSFGNEEQQLAWAKRESE
KAEQERLARLRRQEQEDLELAIALSKADMPSS
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggcggcgctcatccccctcggccagcagttttctgctgggattccattgtacgaaact
tattacaagcaggtagatccaacatacacggggagagttggggcaaatgaagctgcactg
tttcttaagaagtctgggctgtctgatattatccttggaaagatatgggatttggctgat
ccagaaggtaaagggtacttggataaacagggtttctatgttgcattgcgccttgtagca
tgcgcgcagaacggccatgaggttaacctgagcagcctgaacttgactgtgccacctcct
aaatttcatgacactagcagtcccttgctgatcacaccgccttcaacagaaactcactgg
gctgttagggtggaagaaaaagcaaagtttgatggtatttttgaaagccttttgccagta
aatggtttactttcaggagacaaagtaaaaccagttctgatgaattcaaagctacctctt
gatatcctaggaagggtctgggatctcagtgatattgataaagatggtcacttggacaaa
gatgaatttgctgtggcaatgcatttggtttatagagctctcgagaaagagccagttcct
tcactgttacctccttctctcataccaccttctaaaagaaagaagacgcctgtctttcct
ggtgcagttcctgttctccctgcgagtcctccaccaaaagacagcctgcgctctacccca
tctcatggtagtgtaaacagcctgaacagcacggggagtttgtctcccaagcacagcatc
aaacaagcacagccatctgtgaattgggtcgtacccatgtctgagaaagtgcgatatgat
gacattttcctaaaaacagacacagatatggatggttttgtgagtggccaagaagtaaag
gacatttttatgcattcaggtctgtctcagaatctcctagcacatatatgggctttggca
gatacaagacagataggaaagctaagcaaagatcagtttgcactagcaatgtatctcatt
caacagaaggtcagtaaagggattgatcctccacaagtgttgtccccagatatgatccct
cccacagagaggaatacgcccatacagactctgtcaggttacttgactcctgtaggaact
gaaatctcagcactaacagaaatgcgtcgtgatagttcaagttctgttggatcaggagaa
tttacaggggtgaaggaactggatgacattagtcaagaaattgcacagctgcagagagag
aagtattctctggagcaggacattagggaaaaggaagactcaattagacagaaaacgaat
gaagttcaggaactgcaaaatgatttagatagggagacaagtaacttgcaagaacttgag
gctcagaaacaagatgcccaggaccgcctggatgaaatggaccaacagaaagccaaactg
aaggatatgctgaatgatgtaaggcagaaatgccaggaggaaacacaggtgatttcatca
ctgaaaatgcagattcaatctcaggaatcagatctaaagtcacaggaagatgatcttaat
agagcaaaagcagagctgaatcgcctccagcaagaagagacacagttagagcagagtatc
caggctggaaaagtgcagcttgaaacgataatcaagtctttaaaatcaacacaggaagaa
ataaaccaggcaagaagtaaactttctcaacttcaagagagccatcaagaagtcaataag
agtatagaagaatataatgaagctctcaatggggttaatggtggtagcttgacaaattta
gcagacataagtgaaggccttgggcagacagaaagaagcaattatggagcgatggatgat
ccatttaagaataaagccttgatgttcaccaataacacacaagaattgcatacagaccca
ttccagtcagaggatcctttcaaatctgatccgtttaagggagcagaccccttcaaaggc
agtgacccattccagcatgatccttttgcagagcagccacctgctccagcagatcctttt
ggaggtgatccatttaaggaaagtgatccatttcgtagttctgcccctgaggatttcttc
aagaaacaggtgaagagtgacccgtttacatcagatccattcacaaaaccctccacttta
ccctcaaagcctgatccttttgaaagcagtgatccttttacctcttccagtgtctcttca
aaaggtccagatccatttggaacattggatccctttggaagtggcgctttcagtagtagt
gaaggatttgcagatttcagtcagatgtcaaagtcagtagcttcagaccctttcacctcc
tcctttggaggaatgggattctcagatgaccctttcaaaagcaaatcagacacaccagca
ttaccaccgaagaaaaatgtccctccacggcccaagccacccagtggtaaaagcactcct
gtaagccaccttgggccttcagattttcccaagccccatgatccattccagccgtttggg
gctgacagcagtgacccgtttcagagtaaaaaggggtttggggacccatttagtggaaaa
gatccatttgctccctcctcttcaagtaaaacttctaaagactcttccttggggtttgca
gacttcagctcttttggaaatgaagagcagcagctggcttgggcaaagcgtgagagcgaa
aaagcagagcaagaaagactggctcggctgcggagacaggagcaagaagacctcgagttg
gccattgcgctcagtaaggccgacatgccgagctcgtag

DBGET integrated database retrieval system