KEGG   Gallus gallus (chicken): 420192
Entry
420192            CDS       T01006                                 

Gene name
PEX2
Definition
(RefSeq) peroxisome biogenesis factor 2
  KO
K06664  peroxin-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    420192 (PEX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    420192 (PEX2)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    420192 (PEX2)
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 Prok-RING_4 zf-C3HC4_4 RDD zinc-ribbons_6 zf-RING_2 zf-RING_5
Other DBs
NCBI-GeneID: 420192
NCBI-ProteinID: NP_001008454
CGNC: 11693
Ensembl: ENSGALG00000035752
UniProt: Q5ZM64
Position
2
AA seq 304 aa
MASSIGNEKSVNPVLRISQLDALELNKALEQLVWSQFTSCFHGFKPGVLAHIEPEVKAFL
WLLLWRFTIYSKNATVGQAILNIQYKNNLSQTEKYQPLSKHQKLWYLIFTVGGRWLEERC
YDLFSNRQLQSVSKIKHYINFGAGLLKLCGLVNFLIFLQKGTFATLTERILGIRSVFCKP
QSVRQVGFEYMNRELLWHGFAEFLIYLLPLINVQKLKLKICSWCFPIANLPNSDKTLATH
YKVCSLCGEWPTMPHTIGCSHVFCYYCIKSNYLFDMYFTCPKCGSEVHSLQPLKYKIEMT
ELHV
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcatccagcattggaaatgaaaagagtgtgaatcctgtgctcagaataagtcaactt
gatgctcttgaactaaacaaagccctggaacaactagtgtggtcccagtttaccagctgt
tttcatggatttaaaccaggggtgttggctcatattgaaccagaagttaaagcttttctg
tggcttttactgtggagattcaccatctattctaagaatgcaactgtgggacaggctatt
ttaaatatacagtacaagaataacttatctcagacagagaaataccaacctctgagcaaa
caccagaagttatggtatcttattttcactgttggcggaagatggttggaggaaagatgt
tacgatttatttagcaatcgccaactgcaatctgtcagcaaaatcaagcattatattaac
tttggagctggacttcttaaactttgtggacttgtaaattttctgatttttcttcagaaa
ggaacatttgcaacacttactgaacgcattctaggaattaggtcagttttttgcaagcca
caaagtgttcgtcaagtgggatttgaatacatgaacagggagctgttgtggcatggcttt
gctgaatttctgatctacttgctaccacttattaatgtacagaaactgaaactcaaaatt
tgttcttggtgtttccctattgccaatcttcctaatagtgataaaacattagcaacccac
tacaaggtatgttcgctgtgtggggaatggcctaccatgccacataccataggctgttca
catgttttttgttactattgtattaaaagcaactatttatttgatatgtattttacctgt
cctaagtgtggctcagaggtacacagtcttcagccactgaaatataaaattgaaatgaca
gaattacatgtttag

DBGET integrated database retrieval system