KEGG   Gallus gallus (chicken): 420228
Entry
420228            CDS       T01006                                 

Symbol
ESRP1
Name
(RefSeq) epithelial splicing regulatory protein 1 isoform X2
  KO
K14947  epithelial splicing regulatory protein 1/2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    420228 (ESRP1)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    420228 (ESRP1)
SSDB
Motif
Pfam: RRM_1 RNase_T
Other DBs
NCBI-GeneID: 420228
NCBI-ProteinID: XP_004940007
CGNC: 11921
Ensembl: ENSGALG00000031076
Position
2:126080245..126111054
AA seq 632 aa
MTASPDYLVILFVTTAGTNGARLGSDERELLQLLWKVVDLRTKKLGHPHDVLVRPDHPEL
TAECQEVTKVDVESLPMAPSLEQALRQFNQSVSNELNIGVGTSFCFCTDGQLHIRQVLHP
ETSKKNILLPECFYSFFDLRKEFKKCCPGSPDISKLDVPAMTEYLNLDKNSSALAYGASR
VEDMGNIILTLISEPYNHRFSDPERVNYKFESGPCSKMELVDDNAVIRARGLPWQSSDQD
IAKFFKGLNIAKGGAALCLNAQGRRNGEALVRFVNEEHRDLALQRHKHHMGNRYIEVYKA
TGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFNVTTEEVLAFFGQHCPVTGGKEGVL
FVTYPDSRPTGDAFVLFACEEYAQNALKKHKDLLGKRYIELFRSTAAEVQQVLNRYSSTP
LIPLPTPPILPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILEFLGEFSTDIRTHGVHMV
LNHQGRPSGDAFIQMKSADRAFLAAQRCHKKTMKDRYVEVFQCSAEEMNFVLMGGTLNRN
GLSPPPCLSPPSYSFPAPSAVVPTEAALYQPSVLLNPRTLQPSTAYYPAGAQLFMNYTAY
YPSMQQRMDLYAQVIRPGECPKNGFAFKGPSS
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgacggcgtctcccgactacctggtgatcctctttgtgaccacggcgggcaccaacggg
gcgaggctgggctcggatgagcgagagctgctccagctcttgtggaaggtggtcgactta
aggactaagaagctggggcacccgcacgatgtgctggtccgccccgaccacccggagctg
acggctgagtgccaggaggtcaccaaggtggacgtggagagcctgccgatggctccgtcg
ctggagcaggcgctgagacagtttaatcagtctgtgagcaatgagctgaacatcggtgta
ggtacttccttttgtttctgtactgatggacagttgcacattagacaggttctgcatcct
gagacttccaaaaagaatatcttactgcctgaatgcttctactccttttttgacttgcgg
aaagagttcaagaagtgttgccctggctcacctgacatcagcaaactggatgttccggcc
atgacagaatatttaaatcttgacaagaacagttcagcactcgcctatggagcctctcga
gttgaagatatggggaacattattttaacactaatatctgaaccgtacaatcacaggttt
tcagatccagaaagagtgaactacaaatttgaaagtgggccttgcagcaagatggagctt
gtggacgacaacgctgtcatccgggcaagagggctcccttggcagtcatctgaccaggac
atagcaaagttcttcaaaggcttaaatattgccaagggaggtgctgcactctgcctcaat
gcccaaggcaggaggaatggggaggctctcgtcaggtttgtaaatgaagagcatagagat
ctagcactgcagagacacaagcatcacatgggaaaccgatacattgaggtatacaaggca
acaggtgaagatttcctgaagattgcaggaggcacttccaacgaggttgcacagttctta
tcaaaagaaaaccaagtgatagtcaggatgcgaggtcttcctttcaacgtgacaacagaa
gaagtactggcgttctttggccagcactgccctgtaacaggagggaaggagggagtccta
ttcgtcacataccctgacagcaggccaacaggggatgcctttgtgttgtttgcttgtgag
gaatatgcacagaatgcactgaaaaagcataaggatttgcttggaaaaaggtacattgaa
ctcttcaggagcactgcagcagaagttcagcaggtgctgaataggtactcttccacacct
ctcattcctctcccaacacctcctattcttccagtattacctcagcaatttgtgcctcca
actaatgtcagagactgcatacgtttgcgtggacttccctatgctgccactattgaggac
atcctggagttcttgggggagttctctacagacattcggacccatggtgttcacatggtg
ctaaatcaccagggacgtccatcgggagatgcttttattcagatgaaatctgcagaccga
gctttcttggctgcacagaggtgtcataagaagactatgaaggacagatacgttgaagtc
tttcagtgttctgctgaagagatgaactttgtgttaatggggggcactttaaatcgaaat
ggcttgtccccaccaccatgcctttcacccccttcttactcctttccggctccttctgcg
gttgtgccaacagaagctgctctatatcaaccatctgtactcctgaacccgcggacgctc
cagccctccacagcatactaccctgctggggctcagctcttcatgaactacacggcgtac
taccccagtatgcagcagaggatggacttgtacgcacaagtgatccggccaggagagtgt
ccaaagaatggatttgcatttaaaggtcccagcagttag

DBGET integrated database retrieval system