KEGG   Gallus gallus (chicken): 420261
Entry
420261            CDS       T01006                                 

Symbol
BAALC
Name
(RefSeq) brain and acute leukemia cytoplasmic protein isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB
Other DBs
NCBI-GeneID: 420261
NCBI-ProteinID: XP_004940042
CGNC: 66370
Ensembl: ENSGALG00000045617
Position
2:129209546..129231629
AA seq 118 aa
MYVKRVRKAGCRNGPRGRLHRARSVSTRQRQGILEDGKSTQTGGTATPATTGILSTEKRT
ISGAQCVNAAGAGPPRQSSFRAAESKRDTQKMSTKEVTINVSKTIRPSDRRITKNCVN
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtatgtaaaacgggtacgtaaagcaggctgcagaaacgggccaagaggacggctgcac
cgcgctcgctctgtaagcacccgccaacggcaaggtattctagaggatggcaaatcaact
cagacaggaggaaccgcaacaccagccaccacaggtattctgagcactgagaagaggacc
atcagtggggcccagtgtgtgaacgccgctggggctgggccaccacggcagagcagcttc
cgagcagcagagagtaaacgggacacacagaaaatgtcaacgaaagaagtcaccattaat
gtctcaaaaaccatcagacccagcgacagaaggataacaaagaattgtgtcaattaa

DBGET integrated database retrieval system