KEGG   Gallus gallus (chicken): 420321Help
Entry
420321            CDS       T01006                                 

Gene name
NDRG1
Definition
(RefSeq) protein NDRG1
  KO
K18266  protein NDRG1
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   420321 (NDRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ndr Abhydrolase_6 Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 420321
NCBI-ProteinID: XP_418430
CGNC: 12124
Position
2
AA seq 402 aa AA seqDB search
MSTEFQDAHLAEVKPLVEKEEAITRLLPDFDVQEQDVETMHGMVHVTMCGTPRGNRPAIL
TYHDIGLNHKTCFNPLFNFEDMQEITQHFAVCHVDAPGQQDGAPSFQAGYIYPSMDQLAE
MLPGILKQFGLKSIIGMGTGAGAYVLTRFALNHPDMVEGLVLININPCAEGWMDWAATKI
SGWTNALPDLVISHLFGKEEIHSNHDLIHTYRQHIINDMNQTNLHLFVNSYNSRRDLEIE
RPVPGLNVVTLQCPVLLVVGDSSPAVDAVVECNSKLDPTRTTLLKMADCGGLPQVSQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGQRSRSHTGEGTRSRSHTGEGT
RSRSHTGEGSRNRSHTDTRIELTPNSASNAEQSGPKSMEVSC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagagttccaggatgctcaccttgcagaggtgaaacctctggtggagaaggag
gaggctatcactcgcctccttccagacttcgatgttcaggagcaagatgtggagaccatg
catggcatggtccatgtcaccatgtgtgggacacctagagggaacagacctgctatcctc
acgtaccacgacattgggctgaatcacaaaacttgcttcaatcctctcttcaactttgag
gatatgcaggaaatcacccagcactttgcagtttgccacgtggatgcacctggtcagcag
gatggggcaccatctttccaagctgggtacatatatccttccatggatcagctggctgaa
atgcttcctggaatcctgaaacagtttgggctgaagagcattattggaatgggaactgga
gctggtgcctacgtcctgaccagatttgctttaaaccacccggacatggtggagggattg
gttctcattaacataaacccttgtgctgaaggttggatggactgggcagcaacaaagatt
tcaggttggacaaatgctttaccagacctggtcatttcacatctctttggaaaggaagag
attcacagcaaccatgacctgatccatacttaccgtcagcatattattaatgatatgaat
caaaccaaccttcatctctttgtcaactcttataacagtcgccgagacctagagattgag
cgccctgttcctggattaaatgttgtcacccttcagtgccctgtgctcctggtggtcggt
gacagctccccagcagtggatgctgtggttgaatgcaattcaaagctggacccaacaaga
acaacacttctgaagatggcagactgtggtgggctcccccaagtttcccagcctgcaaag
cttgcggaagctttcaaatactttgttcagggaatgggatacatgccctctgctagcatg
accaggctgatgaggtcccgcaccgcttctggctccagcgtaacctccttggaaggacag
cggagccggtcccacactggggaaggcacgaggagccggtcccacactggggagggaact
cggagccgatcccacactggggagggttccaggaaccgctcccacacagacacacgcatc
gagctgacgccgaattcagccagcaatgctgagcaatcaggccccaagtccatggaagtg
tcctgctaa

DBGET integrated database retrieval system