KEGG   Gallus gallus (chicken): 420375
Entry
420375            CDS       T01006                                 

Gene name
CDC25A
Definition
(RefSeq) M-phase inducer phosphatase 1
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
gga04218  Cellular senescence
gga04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    420375 (CDC25A)
   04218 Cellular senescence
    420375 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    420375 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    420375 (CDC25A)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    420375 (CDC25A)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     420375 (CDC25A)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    420375 (CDC25A)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    420375 (CDC25A)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 420375
NCBI-ProteinID: NP_001186501
CGNC: 3664
Ensembl: ENSGALG00000038469
UniProt: A0A1D5PY31
Position
2
AA seq 526 aa
MDPAPAASYRRRLLHLSPASPAAVVKSLFPAELSPVSDLRLTMEQLGHGQHENTEQDLGN
KSANGLQRTVSSESTDSGCALDLPGTPSPSDIREETFEKAILASSRLNLRLPLRRIHSLP
QRLLGSSPALKRSHSDSTDCNAFQLLEQNENKENESFEFKKPAKPASRGSVHVHSHDGKS
VLGQRQNSALAQGFPTQEMPTGELENYGPAFLQQSSLTSSESEDDDGFLELLDEQDLKND
EEMPSDVASLWTAPLVTRRPDSRARRCRLFGSSSLPSGVGRTTQKRMERSQEESSPGKSK
KRKSLPGAQSEDSANTKIVKTQSSAAEIESILASDQRDLIGDFSKGYLFHTVDGKHQDLK
YIDSEMIVSVLTGKFASFIKECVIIDCRYPYEYEGGHIKGAVNLHMEEDVEDFLLKNPIP
PSKNKRVIIVFHCEFSSERGPRMCRFVRERDRLGNEYPNLHYPELYVLKGGYRDFFLRCR
SFCEPQSYRPMHHEDFKEDLKRFRTKSRTWAGERSKRELYSRLKKL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggatcccgcaccggccgcctcctaccgccgccgcctcctgcacctctctccggcttcc
cccgccgccgtggtcaagtctctctttcccgccgagctctcgccggtctcagatcttcgc
ctcaccatggagcagctgggacacggtcagcatgaaaatactgaacaagatctgggaaac
aagagtgcaaatggtttgcaaagaacagtgtcctcagaatcaacagactcaggttgtgct
ttggatctgcctggcactccgtcccccagcgacatcagagaggaaacatttgagaaggca
attcttgcatcgagcagactgaacctccgactgcctctcagaagaatacattcactgccg
caaaggctcctgggctccagtcctgctctgaagagaagccattcggattccacggattgt
aatgcttttcagctcctagaacagaatgaaaataaggagaatgaatcatttgagtttaag
aagccagccaagccagcttctcggggttctgtgcacgtccactcacacgatggcaaaagt
gttcttggacaaaggcagaactcggccctggctcagggatttcccactcaagaaatgccc
acgggtgaactggaaaactacgggccagctttcctgcagcagtcttctctgacttcctct
gaaagcgaagatgacgacggattcctggagctcttagatgagcaagatctgaaaaatgat
gaggagatgccctctgatgtggcgagcctctggactgcgccgctggtcaccaggaggccg
gacagtcgggccaggcgatgccgcctctttggctcttcatccctgcccagcggtgtaggc
agaaccacccagaaaagaatggagaggtcccaagaagagagttctccagggaaaagcaag
aagaggaaaagcctgcctggagcacagtctgaagactcagcgaacacaaaaatagtaaag
acacagtcctctgcagcagaaattgagagcattttggccagtgaccagagggaccttatt
ggtgacttctcaaagggttatttgttccacactgttgatgggaagcatcaagatttaaaa
tacatcgactcagaaatgattgtgtctgtcctgactggaaagtttgcaagcttcattaag
gagtgtgtgatcattgactgtcgctatccgtacgagtacgaaggaggacacatcaagggt
gctgtaaacctccacatggaggaggatgtggaagactttctgcttaagaacccaatccct
ccctcgaagaacaaacgggtgatcatcgtcttccactgcgagttctcctcggagcggggg
ccccggatgtgccgctttgtgagggagcgggacaggctggggaatgagtaccccaacctg
cattacccagagctgtacgtcctcaagggggggtacagagacttcttcctgcgatgccgg
agcttctgtgagccccagagctaccgccccatgcaccacgaggactttaaagaggacttg
aaaagatttcgcaccaagagccgaacctgggctggtgagaggagcaaacgggaactgtac
agtcgcttgaagaaactctga

DBGET integrated database retrieval system