KEGG   Gallus gallus (chicken): 420388
Entry
420388            CDS       T01006                                 

Symbol
NKTR
Name
(RefSeq) NK-tumor recognition protein isoform X1
  KO
K12740  NK-tumor recognition protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    420388 (NKTR)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    420388 (NKTR)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 420388
NCBI-ProteinID: XP_004939131
CGNC: 3931
Ensembl: ENSGALG00000030268
UniProt: A0A1D5PD89
Position
2:2020323..2060329
AA seq 1470 aa
MGVQDRPQCFFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGIGKTTGKKLCYK
GTTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDTASRPYADVRVIDCGVLVTKP
AKDALEKKKKVCSDSEASDSSSSGSDPSETSSESEAEDERSRRRKRKRRAKTKQSRKRRK
EERKKEDLRSKRASNQRCSLSDKSDVTEKAVDVSTKRDKPVVRPEEIPPVPENRFLLRRD
VPVVSTEPEPKLLDATPVLTDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDESSE
TPPHWKEEMQRLRTYRPPSGEKWSKGDKLSDPCTSRWDERSASRRSRSWSHNGYSDLSTV
RYSSHHKKHRKKKVKHKKKSKKQKHYKKHKQAKKKKASASSEVESSRSFRKKKSSCDRER
KSRSSSLSSRRSSRRDWSKSDKEDQSSSTFSSRESRSYYRSRSRSRSRSKSRSYSQRSSR
SRSASKSSHSRSRSRSSSNPRHQKTVSNSPRNISTRLNENKLNKPADPVRAVILPSDKVV
IPPVVPESLPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKATHLIPPQTNYNLVVIK
EANTSSYQKQQGSSDSDRSGYSKYRSDKSSDSWQRSRSRSSRSRSYSRSYTRSRSLSSSR
TKSRSSGRSPSLNKYRSDRSGFSESTSYFSLSDDDRHRSKRKSTSGDQNTRSLKVRQETS
SESTLPYKGTKDYDESSQGVKESDSLSSSDFSTDSEHSGKAKGAQEKEGHFQLEGDAQQQ
DKNTFHSVRGEEKSKREWDADHSKKKAVKEQSSEQPRGGAKSKQKSYSCSKWDSESNSER
GEVHRGRGDSKPLSDKEEGEATSGSDTELSVTKRRKTKSNSSEGVLDSDSAWKISKQLSS
SESESSHSNSTHTRGKSKKHKHESKKTPKKSHSKKAKEKSKGKKEKKHKVQKRKEVFHWQ
PPLEFGEEDEEDINEKPVIKDDKEKQLTRGVKDKQQQACEKDETVKDKTGNGEKPSADEN
LLVKNTTPDASPNQNKLNKDSINPNTSTSILNSGINVTTCNNETKHAEESNQNGLDVIQT
DDNMEICTPDRNSPGKVVVDTLSPVILTDKPQSLGASINKDLQTSEQDAVKLGNNLVDFI
NIKEEIGRQENNSVPASSAKDSSLKNEIAENTQSNSIDNKWKPLQGVGNLQPATVSTATE
VKNVASAPEAKPAGLRIEIKAKNKVRPGSLFDEVRKTARLNRRPRNQESSSEEESPSRDD
NSPSRSHSRSRSKSESKSRHRTRSESYSHSRSRSRSSTYSYRSRSYTRSRSRGWYSRDRS
RSRSSSYHSYKSRSRTYSRSRSRSSSYGHHSRSSRSYTYDSYYSRSRSRRSDSYRRSRSY
DRRSRSYGSDSESDRSYSNNRSPSESSRYS
NT seq 4413 nt   +upstreamnt  +downstreamnt
atgggcgtgcaggaccgaccgcagtgcttcttcgacatcgagatcaaccgcgagccagtt
ggtcgaattatgtttcagctcttctcagacatatgtccaaagacttgcaaaaacttcctt
tgcttgtgctcgggtgaaaaaggaattggcaaaacaactgggaagaagttgtgctacaaa
ggcactacgttccatcgcgtggttaaaaacttcatgattcagggtggggacttcagtgaa
ggtaatggaaaaggaggtgaatctatttatggtggctattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaaccgagggaaacataccaatggt
tcccaatttttcataacaacaaaacccgctcctcatcttgatggcgtacacgttgtcttt
ggactggttatttctggttttgaagtaatagaacaaatagaaaatctgaaaactgatact
gccagtagaccctatgcagatgtacgagttattgactgtggggtgcttgttacaaaacct
gcaaaagacgctttggagaagaagaagaaagtctgttctgactccgaagcttcagactcc
tcctccagtggatcagacccttcagaaacctcgtctgaaagtgaagctgaagatgaaaga
agcagaagaagaaagcgtaaaagaagagctaaaaccaaacagtcaagaaaacggaggaag
gaagagaggaagaaagaggatctgagaagcaagcgagcctcaaaccaaagatgcagcctt
tctgacaagagcgatgtaacagaaaaagcagtggatgtcagcacaaagagggataagcct
gtggtacgtcctgaagaaattcctccagtgcctgaaaatagatttttgctgagaagagat
gtgcctgttgtcagtacagaacctgaaccgaagctccttgatgctactccagttctaact
gaccagaaaccatcagtgtctaaatctggacgaaaaattaaaggaagaggcaccatacga
tatcacactccacctcgatcacggtcgtgttctgagtctgatgatgatgagagcagtgag
actcctcctcactggaaagaggaaatgcagagattacgaacatatagaccacctagtgga
gaaaagtggagtaaaggcgataagttaagtgacccatgtacaagcaggtgggatgaaaga
agtgcatcgcggagatcaagatcgtggtcacataatggctattctgatttaagtactgtg
aggtactccagtcaccacaaaaaacacagaaaaaagaaagtgaaacataaaaagaagtct
aaaaagcagaagcattacaagaagcacaagcaagctaagaaaaagaaagcatcagcttca
tcagaggtagaatcctcacgttcattcaggaagaagaaatcgtcttgtgatcgtgagagg
aaatctcgttcctcttcattgtcttctagacgttcatccagaagagactggtctaaatct
gataaggaagaccagagttcatcaactttctcaagcagagagagtcggtcatattacagg
tccaggtccagatccagatctaggtctaagtcaaggtcttattcccaaagaagttccaga
tcaagatcagcctctaaatcatcacattctcgaagtaggtcaagatcaagttctaaccct
aggcatcaaaagactgtttccaattctccacgaaatatttcaacacgattaaatgaaaat
aagttgaacaagcctgctgaccctgtaagagcagttatactaccaagtgataaagtcgtc
atcccacctgttgttccagagagcctccctgtaatacccttaagtgatagtcctccacct
tcaaggtggaagcctgggcaaaaaccatggaagccatcttatgagcgaattcaggaaatg
aaagctaaagcaacccatttaatccccccccagactaactataatttagtagttattaaa
gaggctaacacttcttcgtatcaaaagcaacaggggagttctgatagcgatcgaagtggc
tattccaaatatcgtagtgataaaagctcggatagttggcagagatcaagaagcaggtcc
tctcgaagtaggtcatactcaagatcttacacgagatctagaagtctgtctagctcaagg
acaaaatctcgttcttctggcagatcaccatcactgaacaaataccgcagtgacaggtca
gggtttagtgagtcaacatcttatttttcccttagtgatgatgatagacacagaagcaaa
agaaaatctacatcaggtgatcagaacactcgttctcttaaagtgaggcaagaaacaagc
tctgaaagtacccttccttataagggtacgaaagactacgatgaatcttctcaaggagtg
aaagagagtgacagtttatcatcttcagacttctctactgacagcgagcattctggtaaa
gcaaagggagcccaagaaaaggaaggccattttcaattagaaggtgatgctcagcaacag
gataaaaataccttccattctgtgagaggggaggagaaatccaagcgtgaatgggatgct
gatcattctaaaaagaaagcagttaaagagcaatcttctgagcaacctagaggtggtgca
aaaagtaaacaaaaatcctattcatgtagtaaatgggactctgaatcaaactcagaaagg
ggagaggttcatcgtggtaggggagattccaagcccttgtctgataaagaggaaggagag
gccacatcaggatctgatacagaacttagtgttaccaaaaggagaaaaacaaaatccaat
tcctcagaaggcgttctggattctgatagtgcatggaagataagcaaacagttatcatct
tcagaatctgagagttctcattctaactcaacacataccagaggaaagtcaaaaaaacac
aaacatgaatcgaaaaaaactcctaaaaaatcacattccaaaaaagcaaaagaaaaatca
aaagggaaaaaggagaagaaacacaaagttcagaaaagaaaagaagtgtttcattggcaa
cccccactggagtttggtgaagaagatgaagaagatataaatgaaaagccagttatcaag
gatgacaaagaaaagcagcttaccaggggtgtgaaggataaacagcaacaagcttgtgaa
aaggatgaaacagtcaaagacaaaacaggaaatggtgaaaagcctagtgcagatgaaaac
ctgctagttaaaaatactactcctgatgcctcaccaaatcaaaataagcttaataaagat
agcatcaatccaaacacttcaaccagtatattaaactcaggaataaatgtgactacttgc
aataatgagactaagcatgctgaagaaagcaaccagaatggattggatgtaattcagaca
gatgacaacatggagatttgtactccagatcgtaactcaccagggaaggtggttgtggac
actttgtctcctgtcattctcactgataaacctcagagtttaggtgctagtataaacaaa
gatttacagacctctgaacaagatgctgtcaaactaggaaacaaccttgtagacttcatt
aatattaaagaagaaataggaaggcaagaaaataactctgttcctgcatctagtgctaaa
gacagcagtttgaaaaatgaaattgctgaaaatacacaaagcaattcaattgataataaa
tggaagcccttgcaaggtgttggtaatttgcaaccagctacagtaagtactgccacagaa
gtcaagaatgtggcttcagcaccagaggctaagccagcaggtttaagaattgaaataaaa
gctaaaaataaagtaaggcctggatctctgtttgatgaagttaggaagacagcacgacta
aatcgaaggccaaggaaccaagaaagttccagcgaggaggagtctccaagtagagatgac
aatagtccatccaggagccacagtaggtctcgaagtaaatccgaatctaaatccagacac
cgaacacggtctgaatcgtacagtcactcaagaagtcgatcccgaagctctacatattct
tacaggtcgagaagctatacgagaagcagaagtagaggctggtacagcagagaccggtca
agaagccggagtagttcttaccacagttacaaaagtcgtagtcgaacctatagtagaagc
agatccagaagtagttcttatggtcaccacagtcgatccagtaggtcatacacctatgat
agttactatagcagaagtcgaagtagaaggagtgacagctatcgaagatctagaagttat
gacagaagatccagatcttatggctctgatagcgaaagcgatcgcagttactccaacaac
cgaagtcccagtgagagcagcagatacagctga

DBGET integrated database retrieval system