KEGG   Gallus gallus (chicken): 420435
Entry
420435            CDS       T01006                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04371  Apelin signaling pathway
gga04530  Tight junction
gga04910  Insulin signaling pathway
gga04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    420435 (PRKAG2)
   04068 FoxO signaling pathway
    420435 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    420435 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    420435 (PRKAG2)
   04920 Adipocytokine signaling pathway
    420435 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3 UvsY
Other DBs
NCBI-GeneID: 420435
NCBI-ProteinID: NP_001026136
CGNC: 51258
Ensembl: ENSGALG00000006219
UniProt: Q5ZK07
Position
2
AA seq 328 aa
MLEKLELEDEALEESESDIYVRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFMSEMPKPAFM
KKNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINL
AAEKTYNNLDITVTQALQHRSQYFEGVVKCSMLETLETIVDRIVKAEVHRLVVVNEADSI
VGIISLSDILQALVLTPAGAKQKENESE
NT seq 987 nt   +upstreamnt  +downstreamnt
atgctggagaaactcgagctcgaagatgaagcacttgaagagtcggaaagtgacatttat
gtgcgattcatgaggtcacacaagtgttatgacattgttccaacaagctctaagcttgtt
gttttcgacactacgctacaagtaaagaaggcctttttcgccttggtggcaaatggtgtg
agagcagctccactgtgggagagtaaaaaacagagttttgtaggaatgttaacaattaca
gatttcattaacatactgcatagatactataagtctccaatggttcagatctatgaattg
gaggagcacaagatagaaacctggagggaactttatttacaagagacgtttaaaccttta
gtgaacatctccccagatgcaagcctttttgatgctgtatattcattgatcaaaaacaaa
atccacagattgccagttatagatcccgtcagtggaaatgcactttatatacttacccat
aaaagaatcctcaagttcctccagctttttatgtcagagatgccaaagcctgcctttatg
aagaagaatctggatgaacttggaataggaacttaccacaacattgccttcatacatcca
gacactcctatcattaaagccttgaatatatttgtagagagaaggatatcggcattacct
gttgtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaataaacctt
gctgctgaaaaaacctataataacctagatatcacggtgacacaagccctacagcaccgt
tctcagtattttgaaggtgttgtaaagtgtagtatgctggaaacactggagaccattgtt
gataggatagtgaaggctgaggttcatcgtttggtggtagtgaatgaagcagatagcatt
gtgggtatcatctccctttctgacattctacaggctttggtactcacaccagcaggtgcc
aaacaaaaggagaatgaaagtgaatga

DBGET integrated database retrieval system