KEGG   Gallus gallus (chicken): 420494
Entry
420494            CDS       T01006                                 

Gene name
MYO3A
Definition
(RefSeq) myosin-IIIa isoform X1
  KO
K08834  myosin III [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    420494 (MYO3A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    420494 (MYO3A)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     420494 (MYO3A)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  STE20 family
   420494 (MYO3A)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     420494 (MYO3A)
SSDB
Motif
Pfam: Myosin_head Pkinase PK_Tyr_Ser-Thr IQ Kinase-like AAA_22
Other DBs
NCBI-GeneID: 420494
NCBI-ProteinID: XP_015137539
CGNC: 5772
Ensembl: ENSGALG00000007647
Position
2
AA seq 1669 aa
MLPLTGKTIVFDSFPDPSDTWEIIETIGKGTYGKVFKVLNKKNGSKAAVKILDPVHDIDE
EIEAEYNILKALSDHPNVVKFYGMYYKKDVKNGDQLWLVLELCNGGSVTDLVKGFLKRGE
RMNELIIAYILHEALMGLQHLHENKTIHRDIKGNNILLTTEGGVKLVDFGVSAQLTSTRL
RRNTSVGTPFWMAPEVIACEQQLDSSYDARCDAWSLGITAIELGDGDPPLADLHPMRALF
KIPRNPPPTLQQPELWSSEFNDFINKCLTKDYEKRPTVSSLLQHDFIKQIEGKENVLQRQ
LMEFIDVHQQMGVTEKARFERIHTKKGNYSKSLVSNQEDVDDLATLEVLDENTVTEQLQK
SYAKDQIYTYVGDILIAVNPFRNVDIYSSQHSKLYIGAKRTANPPHIFAVADIGYQSMVT
YNSDQCIVISGESGAGKTQSAHLLVQQLTVLGKANNRTLQEKILQVNNLVEAFGNAGTII
NDNSSRFGKYLEMKFTCGGTVVGAQISEYLLEKSRVVHQAVGEKNFHIFYYIYAGLAEKK
KLAHYKLPEYRPPRYLQNDHFRIVQDFMNNSFYKSQFELIEQCFKVIGFTLEELGSVYSV
LAAILNVGNIEFSAVVSEHMIDKSNISNPVALENCASLLCIQADELQEALTSHCVVTRGE
TIIRPNTVEKATDVRDAMAKALYGRLFSWIVNRINTLLKPDKHLSGSDEGLNIGILDIFG
FENFKKNSFEQLCINIANEQIQFYFNQHVFAWEQNEYLYEGVDARVIEYEDNRPLLDMFL
QKPMGLLSLLDEESRFPQATDQTLVEKFEDNLKSKYFWRPKRVDLTFGIYHYAGKVLYNA
SGFLAKNRDTLPADIVLLLRSSENNLIRQLVTHPLTKTGNLAHSKSKTTISYQMWTPQKS
ISRTKNESGDTGHHPRETTSMKTQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPNNDRQA
NKFDKEKVLVQLRYTGILETARIRRQGYSHRILFANFIKRYYLICYKTNDDPPVSPETCA
AILEKAHLDNWVLGKTKVFLKYYHVEQLNLMRKETVDRIILIQAYVRGWLGSRRYKKIKE
QREQSAIKIQSAYRGFVARKEYQNAKHNQKIEKYIIRLQAIARGYLLRKKRKELTEARNK
AATTIQSHYRGYKERKSFKRRRESLRKKETENAASSSEKEKEKELQENEECTAGVKSDLP
KTEEEAAIIVQSNYRGYRARKKIKEERKKIAEEELSVVEYLEAQLQPAEDVTLEEAANED
TQGEGDAVNDNEHTGKSDIGNIREQKVISTKEERASVKLRPAVEHSDKGEEQASLKESSS
KASVKITAEPGPQQEQANQDTLSADGQNQESAVVQPETNKDVERNHLKREEMIPRGCKGI
VRKESLRGSRKQAEAEKQSLEDKEKAAVVIQSSYRGYRRRGQLRKEGKLPCKSQENTAKE
STEAVHIQNKDPQTKKNKESNVTEAESSKTLKGGSEKETCDLAAFSRQISKLSEDYLALQ
QKLNEMILSHQLRPVMMSKDKQTNNQHSSHVCQSVAAKVEDTRPLQRPPRRPRKPKTLNN
PEDSTYYTLIHKSIQDEKRKPRKESLGKVLDLDIYYHEISSTGSTSKDSSSTTKRKRHPV
ERRTSALRATERSRVAESPLEESRAEDNPYDYRRLLRKTSQRRRLIQQF
NT seq 5010 nt   +upstreamnt  +downstreamnt
atgcttccattgactgggaaaacaatagtatttgatagctttcctgacccttcagatacc
tgggaaataattgagactattggcaaaggaacttatggaaaagttttcaaggtattaaat
aagaaaaatggcagcaaagcagcagtcaaaatcttggatcctgttcatgatattgatgaa
gaaattgaagctgagtacaacattttgaaagctctctctgatcatcccaatgtagtcaaa
ttctatggcatgtactacaagaaagatgtgaaaaatggagaccagctttggcttgttctt
gagctgtgcaatggtggatctgtgactgatcttgtgaaaggatttctgaagagaggtgaa
agaatgaatgaacttataattgcttacatcttacacgaagctctgatgggacttcagcat
ttgcatgaaaacaaaactatccaccgtgatattaagggaaataacatccttttgaccact
gaaggaggagtcaagcttgtggattttggtgtgtctgctcagctgaccagcactcggctc
cgccggaacacctccgtgggcaccccattctggatggctccagaggtcattgcctgtgag
caacagctggatagctcctatgatgccagatgtgatgcatggtcactgggtattactgca
atagagctgggagatggagatccaccccttgctgatttgcaccctatgagggcactcttc
aaaataccaaggaatcctcctccaacactacagcagcctgaactgtggtcatctgaattc
aatgacttcattaacaagtgcttaactaaagactatgagaagcgcccaacagtgtctagt
cttttgcagcatgattttattaagcagattgaaggaaaggaaaacgtgctacaaagacaa
cttatggaatttattgatgttcatcaacaaatgggagtcactgaaaaggcaagatttgaa
cgtattcatacaaagaaagggaactacagtaagtcactagtttcaaaccaagaagacgta
gatgatttagcaaccttggaggtactggatgagaatacagtgacagagcagttgcagaag
agttatgccaaggatcagatctacacatatgttggggacattctcatagctgtcaatcca
tttcggaatgtagacatttattcttcacagcattccaaactgtatattggagccaaacgg
actgccaaccctcctcatatttttgctgttgctgacattggttatcagtccatggtgaca
tacaactctgatcagtgcatcgttatttctggggaaagtggagctggcaagacacaaagt
gcccatcttctagttcagcagctcactgtcctgggcaaggctaataacaggactctacag
gagaaaatcctccaggtgaataaccttgtagaagcatttggaaatgcaggcactatcatc
aatgataactccagcagatttggaaaatatttggaaatgaaatttacttgtggaggcact
gtagtaggagctcagatttcagagtacctccttgaaaaatccagagttgtccaccaggca
gtaggagagaaaaatttccatattttttattatatttatgctggtcttgcagaaaagaaa
aaactggcccattacaaattgccagaatacagacctcccagatatctgcaaaacgatcat
ttcagaatagtgcaagactttatgaacaatagcttttataagtcgcagtttgaattaatt
gaacagtgcttcaaagtcataggctttactctggaggaacttggaagtgtatacagtgtt
ctggctgccattctgaatgtgggtaacattgaattttctgcagtggtatctgaacacatg
attgacaagagcaacatttccaatccagtagcccttgaaaactgtgcatccttgctgtgt
attcaggcagacgaactgcaagaggccctcacctctcactgtgtagtgactcgaggagaa
acaattattcgtcccaacactgtggaaaaagccactgatgtcagagatgcgatggccaaa
gctctctatgggcgcctgttcagctggatagtcaatcgcatcaacactcttctcaaacct
gacaaacatttaagtggaagcgatgagggtttgaacattggaattcttgatatctttggc
tttgagaatttcaagaagaattcttttgaacaactctgtatcaacattgccaatgaacag
attcagttctacttcaatcaacacgtctttgcctgggaacagaatgagtacctatacgaa
ggtgttgatgcgagagttatagaatatgaggacaacaggcctctcttagatatgttcttg
cagaaaccaatgggcttattatccctgcttgatgaagaaagtcgattcccacaagcaaca
gatcagacacttgtagaaaaatttgaggataatttgaagtcgaagtatttttggagaccc
aaaagagtagatttaacgtttgggatttatcattatgcaggaaaggttctgtataatgca
agtggattcctggccaaaaatagagatactctgccagctgatattgtgctgcttctgcga
tcatctgagaacaatctgatacgacagttggtaacacatcctcttacaaaaacaggtaac
ctggcacacagtaaaagcaaaactacaatcagttaccagatgtggaccccccagaaatca
atcagtcgtacaaagaatgaatcaggagatactggacatcatccaagagagacaaccagt
atgaaaacacaaacagtcgcttcttatttcagatactctctcatggatttgttatccaaa
atggtggttggccagcctcattttgtccggtgcatcaagccaaacaacgaccggcaggca
aacaagtttgataaagaaaaggtgctggttcagctgcgttacacaggaattctggagaca
gcaaggattcgaagacagggttattcgcaccgcatactctttgcgaacttcataaaacgg
tattatctcatctgttacaaaacaaatgatgatcctccagtcagcccagaaacgtgtgct
gccatcttggaaaaagcccaccttgacaactgggttcttggaaaaactaaagtattcctc
aaatactatcatgtggaacagctgaatttaatgcgaaaagagacggttgataggattata
ttgattcaagcttatgtcagagggtggctgggctcaaggagatacaaaaagataaaggaa
caaagggaacaaagtgctattaaaatacaatcagcttacagaggttttgttgctcgtaaa
gaataccagaatgcaaaacataatcaaaaaattgaaaaatacatcattagacttcaagca
attgccagaggttacttactcaggaagaagagaaaagaactaaccgaggcaaggaacaaa
gcagcaacaacaattcaatctcactacaggggatataaggagaggaagagcttcaaaagg
aggagggaatcacttagaaagaaagaaactgagaatgcggcatcctctagtgaaaaggag
aaggaaaaagaacttcaagaaaatgaggaatgtacagctggagtgaagagtgaccttcct
aaaacagaagaagaagcagctatcattgttcaaagcaattacaggggttacagagcccgt
aaaaaaataaaggaagaacgcaaaaaaatagcagaggaagaattatctgttgtggaatat
cttgaagcacaactgcagccagctgaagatgttacactggaagaagcagcgaatgaggat
actcaaggagaaggtgatgctgttaatgataatgagcacactgggaagagtgacatagga
aatatacgggagcaaaaggtaatatctactaaagaagagagagcgtctgtgaaactgagg
cctgcagtagagcattctgataaaggtgaagaacaggcatccttgaaagagtcatccagc
aaagcatctgtcaaaatcacagctgaacctggtccccagcaggagcaagctaaccaagac
acactgagtgcagatgggcaaaatcaagaatctgctgtggtccagcctgagacaaacaag
gacgtggaaagaaaccatctgaaacgtgaagaaatgatacctagaggatgtaaaggaatt
gtgagaaaagagtcactaagaggttcacggaagcaagctgaagcagaaaaacagagttta
gaggacaaagagaaggcagcagtggttattcagagcagttaccgcggttacagaaggaga
ggacaactcagaaaagaagggaaattaccttgcaaaagtcaagagaacactgcaaaggag
tcaacagaagcagtacacattcaaaataaagatccccaaacaaaaaaaaataaggaaagc
aatgtgacagaggctgagagctctaagacactgaagggaggatctgaaaaagagacctgt
gatttggcagccttttcacggcagatatcaaaattatctgaagactacttagcattgcag
caaaaattaaatgaaatgatactgtcgcatcagctgagacctgtgatgatgtccaaagat
aagcaaactaacaaccaacattcttctcatgtttgtcagtcagttgcagccaaagtagaa
gacactcgcccactgcaaagacccccaaggaggccacggaagcccaagacattaaataac
cctgaagattccacctactacactctaatacataaatcaatacaagatgaaaaacggaaa
ccaagaaaagaaagtctgggcaaggtgctagatttagatatctactaccatgaaatttca
tctactggttccacctcaaaggacagcagctctaccacaaaaaggaagagacatccagtc
gagcgcagaacttcagctttaagagctactgagaggtcaagggttgcggagagccccctg
gaagagagcagagcggaagataatccctatgactaccggaggctgctgcggaagacctcg
cagcgccggcgccttatccagcagttctag

DBGET integrated database retrieval system