KEGG   Gallus gallus (chicken): 420500
Entry
420500            CDS       T01006                                 

Gene name
ARHGAP21
Definition
(RefSeq) rho GTPase-activating protein 21
  KO
K20315  Rho GTPase-activating protein 21/23
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    420500 (ARHGAP21)
Membrane trafficking [BR:gga04131]
 Endosome - Golgi transport
  Others
   Others
    420500 (ARHGAP21)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    420500 (ARHGAP21)
SSDB
Motif
Pfam: RhoGAP PH PH_9 PDZ_6 PDZ PDZ_2 PH_11
Other DBs
NCBI-GeneID: 420500
NCBI-ProteinID: NP_001170828
CGNC: 5838
Ensembl: ENSGALG00000007721
Position
2
AA seq 1993 aa
MPYLVEKFSSMLYTAVLNNFLREANASKNKDGKEQSEAISPSEEEEAFSWPGPKTVVLRR
TSQGFGFTLRHFIVYPPESAVQFSFKDEENGNRQGKQRNRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSMLELSVMPKDEDILQLLQFTKDVTAL
AYSQDAYLKGNEAYSGNAHNIPEPPPICYPRLTSTTSVVAQAGDKLSSDFSLGKQQVGRP
VRALTQPERAYRMEIQVPPSPTDIAKSNTAVCVCNETVRTVIVPSEKAVDLPSCRNNHAG
PSHRTEEIRYGLKDQTTLKARTTSPSSSVSTAIVLPQTPLTRPGDPNGTVIKASNYVVCP
EGIPSTRPSVQATDSSSVSTNHYSSPSSHQHIDWKNYKTYKEYVDNRRMHMYGSRTIQER
LDSLRAASQNTTDYNQVVPNRTASQVRRRSTSHDRVPQSAQIRQRSVSQERLEDSVLMKE
WPRSASQDTLTSPSISARNHRARSWDYLSKQGEMLENFHSENLIADTNGDRRKTYKWTGF
SEQDDRRGIYERPRQHAFHMSLRGQNFPMAPSGYISDSRRVGSRASLPGSHFQKVPPDIR
MLQTSRELQTPGGISKPTAVSQERSSLTTARSSKSSSLKNSSYAAKPSFPLNQSLDVLAS
KDQRTVNHLHQSGLLNQQSRIRGEGAPDHRTETGKTVQPSSLSPTSAKLVQQTSESSATS
DNTGVSIRKKSHDFERENAHEPEILQTDVQGNDKDAVVMRDKSPSGHQTPQPLRHQSYIL
AVNDQEAASDTTCWLPNDARREVHIKRIEERKASGSTPPGDSLASIPFIDEPTSPSIDHD
IAHIPASAVISASASQAPAITTVPPSPTSPIPLIRRQLSHDHESIRPSVLDSQPATKPER
SKSYDEGLDDYRDEEKSSIKHVSSLKGIKVTDSQKSSEDSGSRKDSSSEVFGDASKEGWL
HFRQLVTDKGKRVGGSIRPWKQLYVVLRGHSLYLYKDKKEQMTPSEEEQPISINACLIDI
SYCETKRKNVFRLTTSDCEYLFQAEDRDNMLAWIKAIQENSNLNDEDTGVTSRDLISRRI
KEYSTMMSKTEPSPKTPRQSLSIRQTLLGTKADQRTQSPHSPKDESERKLLTKDETSPPK
DKGTWRKGIPSIMRKTFEKKPSAVGTFGVRLDDCPPAHTNKYIPLIVDICCKLVEERGLE
YTGIYRVPGNNAAISSMQEELNKGMTDIDVHDDKWRDLNVISSLLKSFFRKLPEPLFTND
KYADFIDANRKEDPVERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNL
AIVFGPTLVRTSDDNMTHMVTHMPDQYKIVETLIQKHDWFFTEDDAEEPLTAVQEENTVE
SQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGKDQYSKELLVSSIFAAAS
RKRKKTKEKPQPSSSEDELDNVFSKKELAEQSRGDTAKEDTAKGEYEKERDAGRKQRMFV
LKEKENSSKKDVNVVKDEKKSLRKESVLSEESSLPYREKHTKSQSLSCQQTVQKDNPKMP
ISQSSSQVEETVSDSGTMLSTSSQASQHRYSCKKVASPEIKHSEFLAADVSSITSDYSTT
SSSVYITGLDASMMSPEVQSVTESKGEDADDERSELISEGRPMETDSESDFPVFATSSAA
ERLSKGKVSEVFKSSRRNSEESEVSCTEGSSTPKLESRRLFSSHKLIECDTLSRRKSARH
KTDSEGSGDAKSEKDLPTVTKMFDIMKKGRSTSSLATSARSETDKQEPTWRLKITDRLKL
RLKSSADDMFGVGNQKTNSAETAKRKNIRRRHTLGGQRDFDEISVLNVWKVQEPSQSRER
ESELSAVNRLKPKCPAQDLSISEWLARERLRTSTTDLNTGETGKPRLENTSLADASKVDL
PLSAEVQADEGSSSSSLTSISRTPPSGPFQPPDQVNGESYQNMNKNNFSPAVDAHPHKLS
GTQVVRSRFYQYL
NT seq 5982 nt   +upstreamnt  +downstreamnt
atgccgtacttagttgaaaaatttagttctatgctgtatacagctgttctgaataacttc
ctgagggaagcaaatgcatcaaaaaataaagatggaaaagagcaaagtgaagctatatca
ccatcggaggaagaagaggctttctcttggcctggtccaaaaactgttgtgttaaggagg
acatctcagggttttggcttcaccttaagacacttcatagtttaccctccagaatctgca
gttcaattttcttttaaagatgaagagaatggaaatagacaaggaaaacaaagaaacaga
ctggagcctatggataccatatttgttaaacaagttaaggaaggtggacctgcttttgaa
gccggactgtgcacaggtgacagaattataaaagtcaatggagaaagcgttattgggaag
acatattctcaagtcattgctttaatacagaacagtgacagcatgttggaacttagtgtt
atgccaaaagacgaggacatccttcaattgctgcagtttacaaaggatgtcacagcactg
gcgtattcccaagatgcctacctgaaaggcaacgaagcttacagtggtaatgcccacaac
atacctgaaccaccaccaatatgttatccacgcctgacatctaccacttctgttgtggca
caagctggtgacaagctatcttctgatttctcactggggaaacagcaagtcggcagacca
gtacgggcattgacacagccagagagggcttacagaatggaaatacaagtgcctccgtca
ccaacagacattgcaaaatcaaatacagctgtgtgtgtttgcaatgaaactgtaaggaca
gttattgtgccttctgagaaggctgtagatttgccatcttgcagaaataatcatgctggt
ccatcacacaggacagaggaaataagatatggcttaaaagatcagaccactctaaaagca
cgaaccacatcaccatcttcttcagtgtccactgccattgtacttccacagactccatta
acaaggccaggtgatccaaatggaacagtgattaaggcttcaaattatgtagtatgtcca
gagggaatcccgagcactaggccttctgttcaagccacagactcttcctctgtctctaca
aatcattacagttctccatcctcacaccagcacatagactggaagaactataaaacctac
aaagaatatgttgataacaggcgcatgcacatgtatggctcccgaacgatacaggaaaga
ttagatagtttaagagcagcttctcagaatacaactgattataatcaagtggtgccaaat
cgcactgcttcacaggtacgacgcaggagcacctctcatgacagggttccacagtctgca
cagatccggcagcgaagtgtatcccaggaacgacttgaagattctgtgttgatgaaagag
tggccacgaagtgcttcacaagatacactaacttcaccttcaattagtgctaggaaccac
agggctcgatcatgggattatctcagcaaacaaggtgaaatgctagaaaattttcattct
gagaatctgatagcagacacaaatggagataggaggaagacttacaagtggacagggttt
tctgagcaagatgatcggcgaggtatttatgagagacctagacaacatgcgtttcatatg
tcccttagaggtcagaattttcctatggctccaagtggttatatttcagacagtaggaga
gtaggtagtagagcttctctgcctggttctcattttcagaaagttccaccagatataaga
atgttgcagacgtctcgagagttgcaaactcctgggggaatttccaaacctacggctgtt
tcacaagaaaggtcctctctcacaacagccagaagttctaaaagtagctctttgaagaac
tcctcctatgcagcaaaaccgtcgtttcccctcaaccagagcttggatgttcttgccagc
aaagaccaaagaactgtaaatcacttgcatcagagcggcctgttaaaccaacagtcaagg
atccgaggagaaggtgccccagatcacagaacagaaacgggcaaaaccgtgcaaccctcc
tctttgtctccaacttctgccaagcttgttcaacaaacaagtgagagttcagctacctct
gataacacaggtgtttccatcagaaaaaagagtcatgattttgaaagagaaaatgcccat
gagcctgaaattctgcaaacagatgttcaaggaaatgacaaagatgcagttgtcatgcgg
gacaaatcaccctctggccaccaaactccacagcctttgaggcatcagtcctacattctt
gctgtcaatgaccaagaggcagcctcagacaccacctgttggttacctaatgatgctcgg
agggaagtccacataaaacgaatagaagagaggaaagcatcaggttccaccccgcctggt
gattccttggcttctattccatttattgatgaaccgactagtcctagtattgaccatgat
attgcacacattcctgcttctgctgttatttctgcatctgcttctcaagcacctgctata
acaactgttcctcccagtcctacatctccaatccctttaattcggcgacagctttctcat
gatcatgagtccattaggcctagtgtcctggatagccagcctgccacaaaaccagagaga
tcgaagtcatatgatgaaggactggatgactatagagatgaggaaaaatcgtccattaag
catgtatctagcttaaagggcatcaaggtcacagacagtcagaaatcttctgaagattct
ggttcccgaaaagattcttcttcagaggtctttggtgatgcctccaaagaagggtggctc
cattttcgtcagcttgttacagacaaaggaaagcgagttggtgggagcattcggccatgg
aaacaattgtatgttgttcttcgaggtcattcactttatttgtacaaggataaaaaggaa
caaatgaccccatcagaagaagaacaacctataagcatcaatgcttgtttgatagacatc
tcatactgtgaaaccaagaggaaaaatgtattcagactcaccacatcagactgcgagtat
ctgtttcaagctgaggacagagataatatgttagcgtggattaaagcaatacaagaaaac
agcaacttaaatgatgaggacactggtgtcactagtagagacctaattagccggaggatt
aaagaatacagtacaatgatgagcaaaacagagccatctcccaaaacacctcgtcagagc
ctaagtatcaggcagactctgcttggaactaaagcagaccagaggacccagagtccacat
tctcccaaggatgagtcagagaggaagcttctcactaaagatgagacaagcccacctaaa
gataaggggacatggaggaaaggcattccaagcattatgaggaagacatttgaaaagaag
ccatctgcagtcggaacatttggtgtcagactagatgactgccccccagcacataccaac
aaatatatcccactgattgttgatatatgctgcaaactagttgaagaaagaggtcttgag
tacacaggtatttacagagttcctggaaataatgctgctatctcaagtatgcaagaggag
ctcaacaaaggaatgactgacatagatgttcatgatgataaatggcgagacttgaatgtc
ataagcagtttgctgaagtccttcttcagaaagctcccagaaccccttttcaccaatgac
aaatatgcagattttatagatgccaatagaaaagaagatccagttgaacgtttgaaaaca
ctgaagaggctgattcatgatttacctgaacatcattatgagacgctcaagtttctttct
gcacatctcaagacagtagcagagaactctgaaaagaacaagatggaaccaagaaacctg
gcaatagtgtttggtccaacgcttgtgaggacatctgatgataacatgacacacatggtt
acgcatatgccagaccaatataaaattgtagaaacactcatccaaaaacatgactggttt
ttcacagaagatgatgctgaagaaccccttacagcagtgcaggaggaaaacactgtagaa
tctcagccagtgccaaacatagatcacttactcaccaacattggaagaacgggagtgtct
cctggagacgtatcagattcagctactagtgactcaacaaaatctaagggttcttggggt
tctggaaaggatcagtatagcaaggaactgcttgtgtcctccatttttgcagcagctagt
cgcaagcggaaaaaaacaaaagagaaaccgcaaccgagtagctcagaagatgagttggat
aatgtgttttccaagaaggagcttgcagaacagtctcggggtgacacagcaaaagaggac
acagctaaaggagaatatgaaaaagagagagatgcagggagaaaacagaggatgtttgtc
ctgaaggaaaaagagaacagcagtaaaaaagatgtgaatgttgtaaaggatgaaaagaag
tcgttaaggaaagagagcgtcctgtcagaggagtcttcactgccttaccgtgaaaaacat
acaaaatcacaaagtctcagctgtcagcaaactgtgcagaaggataaccctaaaatgccc
atttcccagtcttcttcccaggttgaagagacagtgtctgactctggcactatgcttagc
acttcctctcaggcttcccagcacagatattcgtgcaaaaaggtagccagccctgaaatt
aaacacagtgagtttctagcagctgatgtcagttccatcacctcagattattcgacgact
tcatcctctgtgtatataactggcctagatgccagtatgatgagccctgaagtgcagtcg
gtaacagaaagcaagggagaagatgctgatgatgaaagaagcgagttgatcagcgaaggg
cgtccaatggagacagacagtgagagtgacttccctgtctttgccaccagctctgctgct
gagaggctgtccaaggggaaagtttccgaagtgtttaagagcagtcggaggaactctgag
gaaagcgaagtaagttgtactgagggaagttcaacaccaaagttagagagtcgcagactt
tttagctcacacaaactgattgaatgcgatacgctgtccaggagaaagtctgcacggcat
aaaacagacagtgagggttctggggatgcaaagagtgagaaggacttacctactgtgacc
aaaatgtttgatataatgaaaaaaggaagatcgacgagcagtttagctacatcagccaga
agtgagactgacaaacaagaacctacctggagactaaaaattacagataggttaaagctg
cggctcaagtcatctgcagatgacatgtttggagttgggaatcaaaagactaactctgca
gagacggcaaagaggaaaaatatcaggcgaaggcatacgcttggaggacagagggatttt
gatgaaataagtgtcctgaatgtttggaaagttcaagagccgagtcaaagtagagagaga
gaatctgagctttcggctgtgaatcgtctgaagccaaaatgtccagcccaggacctctca
atctcagagtggcttgcacgagaacgtttacgcactagcacaactgaccttaatacgggt
gaaactggaaagcccaggcttgagaacactagcttagcagatgcatcaaaggtagatctg
cctttatctgctgaagtgcaagcagatgaaggcagttcctccagcagcttgacttcaatc
agtagaacaccaccttcgggaccatttcagccgccagaccaggtaaatggtgaaagttat
cagaatatgaacaaaaacaacttcagcccagcagttgatgcccatcctcataaactgtct
gggacccaagtggttagatctcgattctaccagtatctttga

DBGET integrated database retrieval system