KEGG   Gallus gallus (chicken): 420509
Entry
420509            CDS       T01006                                 

Gene name
MLLT10
Definition
(RefSeq) protein AF-10 isoform X3
  KO
K23588  protein AF-17/10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    420509 (MLLT10)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     420509 (MLLT10)
SSDB
Motif
Pfam: zf-HC5HC2H_2 zf-HC5HC2H PHD_2 PHD
Other DBs
NCBI-GeneID: 420509
NCBI-ProteinID: XP_015137504
CGNC: 5995
Ensembl: ENSGALG00000007928
Position
2
AA seq 1071 aa
MARPAETEWQRAEMVSSEPLLLPVSLEGEFSTSMKEMIGGCCVCSDERGWAENPLVYCDG
HGCNVAVHQACYGIVQVPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVV
CALYIPEVQFANVATMEPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQ
AFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSYDQSLSDSSSHSQ
DKHHEKEKKKYKEKDKHKQKYKKQSESSPSLVPSLTVTTEKTYTSTSNNSMSGSLKRLED
TTARFTNANFQEVSTHVSSGKDSSEARGSESKGKKSAGHSSGQRGRKPGAGRNPGTTVTA
ASPFQQGSFLGTPGSIKSSSGSSVQSPQDFLSFTETDLRSDSFTHSQQASSTKDVHKGET
GSQEGGVNCFTSLIGLPSSSAVSQSKNFDSSPGDISNSSLTSTAYKRAQTSGIEEETVTE
KKRKGNKQSKHGPGRPKGNKSQENISHLSVSSASPTSSVASAAGSVTSSGLQKSPTLLRN
GSLQSLSVGSSPVGSGIFSSNDVAVSFPNAVSGSGSSTPVSSSHLPQQASGHLQQVGALS
PSTAPSITTVVAATQANTLPGSSLSLPPSHMYGNRLNPNSAMAALIAQSDNSQADQDVGD
NGRSLAGRGGSPRGSLSPRSPVSSLQVRYDQSGNNCGDSLPPVAASIEQLLERQWSEGQQ
FLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTLTSNP
SPSHQVHAFPVQAAPSTDSLNSSKSPHLGNSFLPDNSLPVLNQEITSSGQSTSSSSALST
PPPAGQSPAQQGSGVTGVQQVNGVTVGALASGMQTVTSTIPAVPGVGGIIGALPASQLAI
NGIVGALNGVIQTPATISQNPSPLTHATVPPNATHPLPTTLNNSASGLGLLPDQQRQLLL
HQQHQQFQQLLSTQQLTSEQHQALLYQLVQQHHHHQHHHQSEVQQLQITGGAQIPINNLL
SGTQASPLNAASTNPFLTIHGDNAAQKVTYFLLHRGSMIKLDQLHQRRVDI
NT seq 3216 nt   +upstreamnt  +downstreamnt
atggcgcgcccggcggagacggagtggcagcgcgccgagatggtctctagcgagccgctg
ctgctgccggtgtcactggagggcgagttctccactagcatgaaggagatgatcggcggc
tgctgcgtgtgctccgacgagaggggctgggccgagaacccgctcgtctactgcgacggg
cacggctgcaatgtcgcagtgcatcaagcttgctatggaattgttcaagtacccactgga
ccctggttctgcagaaagtgtgaatctcaggaaagagcggccagagtgagatgtgaatta
tgccctcataaggatggtgctttaaagagaacagataatgggggttgggctcatgtggtt
tgtgctctgtacattcccgaggtgcagtttgcgaatgtcgctacaatggaacctattgtg
ttgcagtccgttcctcatgatcgttataataagacttgctatatctgtgatgaacaaggc
agagaaagtaaagcagccactggtgcatgcatgacatgtaataaacacggatgtcgacaa
gcttttcatgtaacatgtgcacagtttgcaggacttctttgtgaagaagaaggcaatggt
gcagataatgtccaatactgtggctactgtaaataccattttagtaagctgaaaaagagc
aaacggggatctaataggtcatatgatcaaagtttaagtgattcttcctctcactctcag
gataaacatcatgagaaggagaaaaaaaaatataaagagaaagataaacacaagcaaaaa
tataagaagcagtcggagtcctcaccgtccttggttccatctcttactgtaactacagag
aaaacttacacaagcactagcaacaactccatgtcaggctccttgaagcgtctggaagat
actacggctcgatttacaaatgcaaatttccaggaagtttctacacacgtttcaagtgga
aaagattcttcagaggctagagggtcagagagcaaagggaagaaatctgcaggtcacagc
tcgggtcagaggggaagaaagcctggtgctggaagaaatccaggaacaactgtgactgca
gctagcccttttcagcaaggaagctttttgggcactcctgggagcataaagtcatcttct
ggaagttcagttcagtctccccaggattttttgagttttacagaaacagatctgagaagt
gacagtttcactcattctcaacaggcttcgtcaaccaaagatgtacataaaggagagact
gggagtcaagagggaggtgtcaactgtttcacttccttaattggtctcccttcatcatca
gctgtttcccaatctaaaaactttgacagctcacctggagacataagtaattcaagcctt
acttctacagcatacaaaagagctcaaacttctggaatagaagaggaaactgtaacagag
aagaaacggaaaggaaataagcaaagtaaacatgggcctggtagacccaaaggaaataaa
agtcaagaaaatatttcccatctttcagtttcttccgcttccccaacttcatctgtggca
tctgctgcaggaagtgtgacaagctctggtcttcaaaaatctccaactttgctcaggaat
ggaagtttacaaagtcttagtgttggctcatctccagtgggttcaggtatttttagcagc
aatgatgtagcagtatcatttccaaatgcagtatctggctcaggatctagcactcccgtt
tccagttctcatttacctcagcaggcttcaggccacttgcagcaagtgggagctctatca
ccttcaactgcgccttctataactactgttgttgctgcaactcaggcaaacaccctacct
ggatcatctctcagtctgcctccatcccatatgtatggcaataggctgaatccaaattca
gcaatggcagcacttatagctcagtctgacaacagccaagcagatcaagatgtgggagat
aacggccgcagccttgctggcagaggaggctcgcccagaggaagtctctcgccacgatcc
cctgtaagcagcttgcaggtccgctatgaccaatcaggaaacaactgtggggacagtttg
cccccggtagcagccagcatagaacagctgctggagaggcaatggagcgaaggacaacag
ttcttactggaacaaggcacccccagtgacattttaggaatgcttaaatcattgcaccaa
cttcaggttgaaaacaggaggttggaagagcagatcaagaatctgactgctaaaaaggaa
cggcttcagcttctcaatgcacagctttcggtgccctttccaacactgacttcaaatccc
agcccttctcatcaagtacatgcctttcctgtgcaagcagcacctagcacggattccttg
aacagcagtaaaagccctcatctgggaaacagttttttaccggacaattctcttcccgtg
ttaaatcaggagataacctccagcggacaaagcaccagcagttcatcagctctttccact
ccaccacctgctgggcagagtccagctcagcaaggctcaggagtcacgggagttcaacag
gtcaatggtgtgacagtgggggcactagctagtggtatgcagactgtaacctccaccatt
cctgcagtgcctggtgtgggtggaataattggagcgctgccagccagccagctggcaatc
aatggaattgtaggggctttaaatggggtaattcagaccccagcaacaatatcacagaac
ccttctcctctcactcatgcaaccgtgccacccaatgcaacgcatcctctgccaactaca
ttaaacaacagtgcctcaggactgggattacttcctgaccaacagagacaacttctactc
catcaacagcaccagcaattccagcaattactaagtactcagcaactcacatcggaacaa
catcaggcccttctgtatcagctagtacagcagcaccaccaccaccaacaccaccatcag
tctgaagtacagcaactgcagattactggaggagcacagatacccataaacaacttactt
tcaggcacgcaggcatcaccacttaatgcagcttctaccaaccctttcctgacaattcat
ggagataatgcagctcagaaggtgacatattttctcttacacagaggctcaatgataaaa
ctggaccagttgcatcagagaagagttgacatttga

DBGET integrated database retrieval system