KEGG   Gallus gallus (chicken): 420523
Entry
420523            CDS       T01006                                 

Gene name
CUBN
Definition
(RefSeq) cubilin isoform X2
  KO
K14616  cubilin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    420523 (CUBN)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   420523 (CUBN)
SSDB
Motif
Pfam: CUB EGF EGF_CA CUB_2 hEGF EGF_3 FXa_inhibition cEGF LidA_Long_CC
Other DBs
NCBI-GeneID: 420523
NCBI-ProteinID: XP_001235156
CGNC: 6608
Ensembl: ENSGALG00000008704
UniProt: F1NIW7
Position
2
AA seq 3634 aa
MLWAAPSPGLLVALLLLAGLSCESNHYEKKRQKRNIYDEQPRLSSEQGNLVFHAGSSKNI
EFRTGPLGKIKLNEEDLAEMFSQMRENKAEIQELKKASGVSQNVSHQVSMLASKVTSLDM
KLQSLEQTLQRKACSSNPCENSGTCVNSLDGFFCLCPSNWRGLRCSEDINECQIYAGTAL
GCQNGATCVNTPGSYSCSCTPETYGPRCASKFDDCQGGSQTLCEHGTCVDAERDTPNKPK
YHCICDTGWMSPPGSPACSADIDECSLPNPPCSQNPRVQCHNTLGSYSCDPCPTGWQGNG
YSCQDIDECESDNGGCSTAPMVQCINTIGSFRCGVCPPGYEGDGQTCTQVDSCSINNGGC
HPSATCTSTPGLMPFCSCSPGYTGSGYGPNGCSPLTDICQLQNPCANGQCLAVTSGYFCL
CNAGWTGSNCTENIDECISNPCQNGGSCTDGVNGYTCECTSAWTGPQCQTAQQACGGYLS
GSRGTFSYPNNPSSQHYDTGVSCAWVIQTASNKILHITFPFFHLEASTDCNSDFLQIHDG
ASASMHMLGKYCGSNPPAELFSSHNSLYFWFHSNHAVTAGGFTVQWDSRDPECGGELTAT
YGSISSPGYPGNYPVNRDCFWTISTNPGLLITFAFGTLSLEHHENCSYDYLEIRDGLLSQ
DSVLGKYCSTGSPPPLQTTGPYAWIHFHSDDEVTDKGFHIVYTTSAADPTCGGNYTDSEG
VITSPFWPNSFINSQQCIYIIRQPEDEKIHLNFTHLELESHAGCSLNYIEVRDGDSEMSS
LITRFCHSTVISPITSTSNSLWIKFKSDASVQRASFRAVYQVACGGSLSGEGTIHSPYFP
RMSSQPKTCEWIISQSVSKVVILNFIDFDIRNTTTCDSDYVEVRDGNNTESPLLGKYCGT
AVPSRVQSTRNNLYIKFRASSLTNLGFRAQYWPLDTVCGESLTGSEGTITSPGFPDVYPH
GINCIWTINVQPGYLIRLTFTSFNLPFHSSCRMDYLEIYDNSTMQKLGRYCGRSIPPSLT
SGGNVMMLYFVTDRSISSEGFSANYISLDASKVCSHNYNTETGVLTSPNYPNNYPVQTEC
IYTITVGINRQIVLRFTNFTLEGNLRCTEDYIEIRDGGYETSPYLGKYCGSGLPPVIISH
GNKLWIKFVSDIFGTRKGFSAEWDGTSAGCGGTLTTSSGIFMSPNYPMPYYHSSECYWLL
RGSRGTPFEIQFEQFHLEYHPNCNFDYLAVYDGNSSNAKQLGKFCGNQIPQFINSSGDSV
YIKLRTDSSVHGGGFLAKYKQVCHEVLTVNRSYGVLESLNYPNNYPLGEHCRWTIQTTKG
NTLSYSFTAFDVEDGSNCDRDYLKLYDGPNVQSNLIGTFCGQSLPLAGNSTGTSLHVEFY
SDGLQARSGFQMLWHTNGCGGELSGPSGSFHSPGYPNRYPSNRECIWYIQTTPGSSIQLT
IQEFDVEYHPNCNYDVLEVFGGPDFLSPRLAQLCISRSAQNPLLLSTTGNSAVVRFKTDE
AVTGKGFSASWQENLHGCGGIFQANSGEIHSPNYPEPYSNNTDCSWLIQVDYSHRVLLNF
TDFDIEDHRLCNYDNVTVFDGPSNEAPLLRVLCGTQHPSPITSSRNQMYVRLRSDRTFQH
RGFSARFSEACGSFIESDSVGAAISSPLYPAKYPNNQNCSWIIQAQEPFNHVTLSFTDFD
IENNRQNCTTDFVEILDGNNYDAPLQGRYCGTNMPHPITSFGNALVVNFISNNNITTRGF
HATYAASSSSCGGTFHMDRGAFNSPGYPESYPLNTECVWTILSSPGNRLQLSFTAFQVES
SSGCTKDYLEIREGNATGTLAGKFCGDSLPSNYTSTVGHILWVKFVSDSSGTDVGFRATF
SHLYGNDIVGNRGQIASPQWPRSYPHNSNYQWRISTNASQVIHGRILEMDIENHYRCYYD
KLKVYDGPTIHSRPIATYCGADPASFASSGSTLTIQFQSDSSVTGRGFLLEWYAMEPSAP
TRTIARGACGGTVTSEETPSFLYSPGWPLNYRNFADCVWLIRAPGSTVEFNILALDIESH
SSCYYDRLTIQDGDNGLSPLLATICGREPPGPVRSTGETMFIRFVSDGSVTGAGFNASYH
KSCGGYLHADRGVITSPSYPQEYTPNLNCSWHVLVTSGYIITVHFEQPFQVKSEDASCNS
GDYVELKNGLDASAPPLVSGRGNGRFCGSSPISTMYTTDNQLFVHFISDSRNEGQGFKLK
YEAKSLACGGNIYISDFNPSGYTSSPNYPNNYPSHADCVWTITAPNGHAVELQFEDQFYI
EPSPNCTSSYLELRNGADSSAPVLAKLCGSLLPGSQRSSGAVMYLRFRSDSSSTHVGFNA
KYSIAPCGGTVAGRSGVIESVGYPDLHYPDNLLCEWFLQGPRGHYLTITLEDLDIQNTSE
CASDFVEIREYNASGNLLGRYCGNTLPDAVDTSDSFAYVKFVADGSINARGFRLRFDSST
EECGGDFSAPVGMFTSPNYPNRYPHNRVCEWRITVEEGRRVILTINDMRTEEHWRCSSDY
VAVYNGLRQNSPRLVKLCGEVNPGTEVKSSGNTMKVVLVTDMTHATRGFSVSYTSNEDSV
CGGTLMGYTGGNFSSPGYDGVKNYTSKLNCEWTIENPSHYNSSIYISFEDFHLEHHQDCQ
YDYLELRIGDADGELIARLCGQAAPSVPLVIAAPQVWIHFVSDENTEDKGFLGRYIFEAC
GGIQSGERGFISSPNYPEPYGNLNHCSWLLEAPEGETITLNFTAFHVENHSLCKWDSVTI
LNGGSPGSPVIGRYCGNTSPGIIQSGSNKLLVIFNSDRSIQGGGFYATWTAESLGCGGII
HSDSGMIKSPHWPQNFPMNTRCTWTIITHESKHLEMIFHNNFQIPHSDGSCQSSFVKVWQ
GNHEEEEALLATGCGTSAPDPVIAPNNIVTTVFQSRDAPGRGFSASFISRCGINFTSPAG
RIVSPNYPSQYDNNLNCSYIIDRGPQSLVILEFETFHLEAPALLSRICLYDGVSIFRGTR
VTPHPVITLCGSEVPEPISVFGPMLLNFYTDSHIAGFGFQARYRTIACGGTFSGSVGIIS
SPAHSVLDYHNNMNCSYHITVGSGKAVVLKFNTFQLELSPSCYKDSVAVYDGSDTHAPLL
GKFCGSELPPNMKSSSNQLFLVFNTDFSGSDRGWKASFRETLGPQDGCGGYLTYSAYSFG
SPVSNVSGRYERNLDCVWVITAPVNKLINLTFTSFVLEAHVAQTCQYDYVKLYDGGNENA
NLVGTFCGSIVPAPFLSTSNSLTLKFVTDNSVQREGFSATYTTVDRLCGGTYNATSTSLT
ATSPNFPSEYPPFTLCTWVIDAPPQQQVKVVVETFHLHPSQDCSQNYLQLQDLPMHSQGS
THRFCGNETFPVPEFYSHDRTAIVTFKSDEYRINNGVRFTYQATGCSREYNQPFGYLKSP
GWPGRHPNNMDCSIVLKAPLNHTISLFFHAFSLEDSIQCSHDFLEVRNGSNMQSPLLGRF
CGNTVPSPIFPQSHVVFLRFKSDVSGAHDGYEITWTSSSSGCGGTLYGSTGTFASPRFPA
TYWNNTHCEWVITVPKGRIVTVNFDFISIDDPGDCSSNYLILYNGPDTSYPQAGPYCGMD
TNIAPFTATSHQVYVKFHAEYVTLPSGFRLSWTS
NT seq 10905 nt   +upstreamnt  +downstreamnt
atgctttgggctgctccttctcctgggctgttagttgcgttgctactgcttgctggattg
agctgtgaatcaaaccactacgaaaaaaagaggcagaagagaaacatttatgatgaacag
cctcgtctgtcctcagagcagggcaacctggtgttccacgctggctccagcaaaaatatt
gaatttagaactggaccactggggaaaataaagcttaatgaagaagaccttgcagaaatg
tttagtcagatgagagaaaataaagcagagattcaagaacttaagaaagccagtggagtc
tctcagaatgtatcccaccaagtctccatgctggcttccaaggtcacaagtcttgacatg
aaacttcaaagcttagagcagactctgcagaggaaagcctgcagcagcaacccctgtgag
aactcggggacctgtgtgaactctctggatggcttcttttgcctctgtcccagcaactgg
aggggcctccgctgctcagaggacattaatgaatgccagatttatgctggaacagcgctg
ggctgccagaatggagccacttgtgtgaacacaccaggcagctacagctgctcctgtact
ccagaaacctatgggccccgttgtgcctcaaagtttgatgattgccagggcggatctcag
acactctgtgagcatggcacctgtgttgatgcagaacgagacacccccaacaagcccaag
taccactgtatctgtgacactggctggatgtcccctcctggcagccctgcctgcagtgct
gatatagatgaatgcagccttccaaaccctccatgttcacagaatccacgtgtgcagtgc
cacaacacacttggctcctactcgtgtgatccctgccccacaggctggcaaggaaatggc
tacagttgccaagacattgatgaatgtgaaagtgataatggaggctgttcaacagcacca
atggttcagtgtatcaacacaataggatccttccgctgtggagtctgtccaccaggttat
gagggtgatggacaaacgtgtacccaggttgatagctgctcgataaataatggagggtgc
catccatcagctacttgtacctctactccaggactaatgccattttgctcgtgctcacct
gggtacactggaagtggatatgggccaaacgggtgctctcctcttactgatatctgtcag
ctgcaaaacccttgtgcaaatggtcagtgcttggcagtgacctctggatatttctgcctg
tgtaacgcaggctggacaggctctaattgtacagagaacattgacgaatgcattagcaac
ccctgccagaatggtggaagctgcactgatggtgtcaatggttacacctgtgagtgcacc
agtgcctggacaggaccacagtgccagactgcccagcaagcttgtggagggtatctttca
ggctccaggggcactttcagttaccctaacaacccgagcagccagcactatgatactggg
gtcagctgtgcctgggttattcaaactgcttccaacaagattctgcatattactttcccg
ttcttccatctggaggcgagtactgactgtaactctgacttccttcaaatccacgatggg
gcttcagcatcaatgcacatgctgggaaaatactgtggttccaaccctcctgcagagctt
ttcagttcccacaattccctttatttttggtttcactcaaatcacgccgttactgctgga
ggttttactgttcagtgggactctcgagacccggaatgcggtggcgagctaacagctact
tacggctcaataagctctccaggataccctggtaactatcctgtaaacagagactgtttc
tggaccatctcaaccaatcctggcctcctcattacttttgcctttggtacactaagccta
gaacaccatgagaactgcagttatgactatttagagattcgagatggtcttctttcacaa
gactctgtccttggtaaatactgtagcactggatctccacccccactccaaaccactggg
ccatatgcgtggattcactttcactctgatgatgaagttactgataagggttttcacatt
gtctatacaacatcagctgcagatccaacttgtggaggaaactacaccgatagtgaaggg
gttattacctctcctttctggcctaattcttttatcaacagtcaacaatgtatctacatt
atcagacaaccagaggatgaaaaaatacacctcaacttcactcatttggagctggagagc
catgctggttgctcactgaattatatcgaggttcgagatggtgacagtgagatgtcttct
ctgattaccagattctgtcatagtacagttatatctccaatcacttctaccagcaacagt
ctctggatcaagttcaagtctgatgcttctgtgcaaagggctagcttcagggctgtttac
caagttgcctgtggaggctccctgtctggagaaggcactatccattcaccttacttccca
aggatgtcctcccagccaaagacctgtgagtggatcatctcccagtcagtgagcaaagtg
gtgattcttaactttatcgactttgacattcgaaatacaacaacttgtgactcagactat
gttgaggtcagagatggcaacaacacagaatctcctcttttggggaaatattgtggtaca
gctgtaccatctagagtgcaatctacaaggaacaatctctatatcaaattcagagcttcc
tctcttaccaaccttggcttcagagctcagtactggccattggatacagtatgtggggag
tctctcacgggatcagaaggaaccattacaagtcctggtttcccagatgtctacccacat
ggtattaactgtatctggaccatcaacgttcaacccggctaccttatccgcctgacgttc
acttcatttaacttaccatttcatagcagctgcagaatggattatcttgaaatatatgac
aacagcactatgcaaaaattgggaaggtactgtggaagatcaattccaccatctcttact
agtggtggcaacgtgatgatgttgtactttgtgactgaccgcagcatttcttctgagggc
ttctcagctaattatatctccttggatgcatcaaaagtgtgctcacacaactacaatact
gaaactggtgtgctgacatctccaaactatccaaataactaccctgtccagacagagtgc
atctacaccatcacagtgggaataaacagacagattgtgctgcgcttcaccaacttcact
ctggaagggaatttacgctgcacagaggattatatagaaatcagggatggaggctatgaa
acttctccttatcttggaaaatactgtggttcagggctgcctccagttataatttctcat
ggtaacaagctgtggatcaagtttgtaagtgacatatttggcacaagaaaggggttttca
gcagaatgggatggtacatcagcaggttgtggtgggactttgacgacaagttctggcatc
ttcatgtctcccaactaccctatgccatattatcacagttcggagtgctactggttgctc
agaggaagcagaggaaccccatttgaaatccagtttgaacaatttcatctagagtatcac
ccaaactgcaactttgattaccttgcagtatatgatggcaacagcagcaatgctaaacag
cttggtaaattttgtgggaatcagataccacaattcatcaattcaagtggagacagtgtg
tacataaaactgaggacagatagcagtgtgcatggtggaggttttttagctaaatacaaa
caagtttgccatgaagtgctcactgttaaccgaagctatggcgtattggaaagtttaaat
tatccaaataattacccactgggggagcactgcagatggactattcagaccacaaagggg
aatacactcagctatagcttcacagcctttgatgtagaagatgggtctaactgtgaccgt
gactacttgaagctctacgatgggcccaatgtacagtccaacctgataggcactttctgt
gggcagtctcttccactggcagggaacagcacgggcaccagccttcatgtggaattttat
tctgatggactgcaagctagaagtgggttccagatgctgtggcacactaatggttgtgga
ggagaactctctggcccttctggttcatttcacagtcctggctaccccaacagatatcca
agcaacagagaatgcatctggtacattcaaacaacgcctggtagcagcatccaactcacc
attcaggaatttgatgttgaatatcacccaaactgcaactatgatgttttggaggtcttt
ggtggccctgatttcctctctcccagactagcccagctgtgtatttcgagatcagcacag
aaccccctcctactctctactactggcaattcggctgttgtccgtttcaagacagatgaa
gcagtgactgggaaaggtttcagtgcttcctggcaagaaaatctgcatggctgtggtggt
atttttcaagcgaacagtggggaaatccattctccaaactatcctgagccttatagtaac
aacacagactgttcttggcttatccaagttgactacagccacagagtcctattgaacttc
acggattttgacatcgaagatcaccgtttatgtaactatgacaacgttactgtttttgat
ggtcctagcaatgaagcaccccttcttagagtactctgtggaacacaacatccttctcct
atcacatcctccaggaatcagatgtacgtccggctgcgctctgatagaaccttccagcac
aggggcttcagtgctcgctttagtgaagcgtgcggaagtttcatagagtcagattcagtt
ggggcagcaatttcctctcctctgtatcctgccaaatacccaaacaatcagaactgcagc
tggattattcaggctcaggaaccattcaaccacgtcacactgtccttcactgattttgat
attgaaaacaatagacagaactgtacaacggattttgtggagattttggatgggaataac
tatgatgctcctcttcaaggccgttactgtggtactaacatgccacatcctatcacttct
tttggtaatgctttggtggtcaacttcatctccaacaacaacattactaccaggggcttc
catgccacctatgctgcatcatcatcatcatgcggaggtactttccacatggacagagga
gctttcaacagccctggctatcccgagtcgtatccactcaacactgagtgtgtctggaca
attctcagctcccctggcaaccggctgcagctgtctttcacagcatttcaagtggaatct
agtagcggctgcaccaaagattacctggaaattcgtgaagggaatgctactggcacgctg
gcaggaaaattctgtggagactccttaccttcaaattatacatctactgttgggcatatc
ctgtgggttaaatttgtctcagacagctcaggcactgatgttggcttcagggccacattc
tcacacttgtatggaaatgacattgtgggaaacagaggacaaatagcttcaccacagtgg
cccagaagctaccctcacaattcgaattaccagtggaggataagtaccaatgcatcacaa
gttatccatggccgtatcctggagatggatattgaaaatcattacagatgctactacgac
aagctaaaggtatatgatggtcccaccattcattctcgtcctattgcaacatactgtggt
gcagatccagcttcttttgcatcctctggcagcacattgacaatacagttccagtcagat
tcatctgtgactggaagaggctttcttttagagtggtatgcaatggagccttctgctccc
acacgcacaatagctagaggtgcatgtggagggactgtgacaagtgaagaaacaccttca
ttcctctactcgccaggctggcccttgaattacagaaattttgctgactgtgtgtggctt
atcagagctcctgggtccactgtggagtttaacatcctggccctggacattgaatcccac
agttcatgctactatgacagacttactatccaagatggagacaatggcctttctccattg
ctagctactatatgtggacgagaacctcctgggccagtaagatcaactggagagacaatg
ttcattcgcttcgtgtcagatggaagtgtcactggagctggatttaatgcctcatatcac
aaaagctgtggaggctatttgcatgcagacaggggtgtgatcacatcccccagctaccct
caggagtacactcctaatctgaattgttcctggcatgtactggtaacctctggatatatc
ataaccgtccattttgaacaaccttttcaggttaagagtgaggatgcttcctgcaactct
ggtgattacgtagagcttaagaatgggctagatgcttctgccccacccttggtatctgga
aggggaaatggacgcttttgtggaagcagccccatctctaccatgtacaccacagacaat
cagctttttgtccacttcatttctgacagcaggaatgagggtcaaggattcaaactgaaa
tatgaggctaagagtctagcttgtggagggaatatttatatcagtgatttcaaccccagt
ggatatacatcttcccccaactatccgaacaattacccctcgcacgctgactgtgtctgg
accataactgctcctaatggacatgcagtagaactgcaatttgaagatcagttttacatt
gaaccttcaccaaattgcacttcaagttacctagagctacgtaacggtgctgactcgagt
gcccctgttcttgccaagctttgtgggagtttgttgccaggctcacagagatcctcggga
gctgtcatgtacctgagattcagatctgacagcagtagcacccatgtgggatttaatgct
aaatattcaattgctccctgtggcggtacagtggcaggacggagtggagtcattgaaagc
gtgggatatcctgaccttcactatccagacaacctgctgtgcgaatggtttctgcagggg
cccaggggccattatcttaccatcacactggaagacctggatattcaaaacacctctgaa
tgtgcaagtgactttgtggagatccgagaatacaatgcttctggaaatttgttgggcagg
tactgtggtaacactctccctgatgctgtggatacctctgacagttttgcttatgtcaag
tttgttgctgatggatcgataaacgcccgaggattcagactgcgctttgattccagtact
gaagaatgcggtggggatttttctgcccctgttggaatgtttacttcaccaaactatccc
aaccgatacccacataatcgagtgtgtgaatggaggatcacagtggaagaaggtcgacgt
gtcatcctaaccattaatgatatgagaactgaagaacactggaggtgctcatctgattat
gtggctgtttacaatggcctcagacagaactctccccgtctggtcaaactgtgtggtgag
gtaaacccaggcactgaggtgaaatcctctggaaacactatgaaagttgttttggtaaca
gatatgacccatgcaaccagaggcttcagtgtctcatacacatccaatgaagattcagtt
tgtggtggaactctgatgggatatacaggtggaaatttctcttctcctggttatgatggt
gttaagaattacacaagtaaactgaactgtgaatggaccattgaaaatccctcccactac
aactcttccatatatatctcttttgaggatttccacttggaacatcatcaggactgccag
tacgactatttagagttacgcataggggatgctgatggagagctaatagccagactctgt
ggtcaggctgcaccatcagtgccacttgtgatagctgcgccccaggtttggatacacttt
gtaagtgatgaaaacactgaagataaaggattcttgggccgttacatatttgaagcctgt
ggtggtatacagtcaggtgaaaggggatttatctcaagtcctaattacccagagccatat
ggcaacctgaatcactgctcctggctgttggaagcccctgaaggtgaaaccatcactctc
aattttacagccttccatgttgaaaatcattcgctctgtaagtgggactctgttactatc
ctgaatggtggctctcctgggtctcctgtcataggaaggtactgtggaaacacatcccct
gggatcattcagtcaggctccaacaagctactggttatctttaactctgaccgctcaatt
caaggaggtgggttttatgcaacgtggacagcagaatctctaggatgtggtgggatcatt
cattcagatagtggtatgatcaaatctcctcattggcctcaaaactttcccatgaacacc
agatgcacgtggaccatcattacgcatgaaagcaaacacctggagatgatcttccacaat
aacttccagatcccacatagtgatggaagctgccagagcagttttgtgaaggtgtggcaa
ggaaatcatgaagaagaggaagctttgctagctacaggatgcggaacttcagctcctgac
cctgttattgctccaaacaatatcgtaacaacagtttttcagtctcgggatgctcctggg
cgaggtttctctgcatctttcataagcagatgcggaataaattttaccagtcctgcaggt
cgcattgtctctcctaactaccctagtcagtatgacaacaacttgaactgcagttatatc
atagatcgggggccgcagtcactggtaatcctggagtttgagactttccacttggaagct
ccagcgctcttgagcaggatctgtctttatgatggagtaagcatcttcaggggcaccagg
gttaccccacaccctgtcatcacgctctgtggaagtgaggtccctgagcctatcagtgtc
tttgggcctatgctgctcaacttctacacagactcacacattgcaggctttgggttccag
gcaagatatagaactattgcttgtggtggcactttcagtggctctgttggcattatcagc
agtccagcccattcagttcttgattatcacaacaacatgaactgttcataccacatcaca
gttggaagtggaaaagcagtggtcctcaaattcaacaccttccagcttgaattatctccc
tcctgctacaaagattccgtggctgtatatgatggctcagacacccatgctcctctcctt
gggaaattctgtggatcagaactgcctccaaatatgaaaagctccagtaaccaattgttc
ctggtatttaatacggacttctctggatcagatagaggatggaaagcatcattcagggag
actttaggacctcaagatggctgtggtggctacttgacatattcagcttatagttttggc
tctccggtctccaacgtgagcggaagatatgagagaaatctggactgtgtgtgggtcata
actgcacctgtaaacaagctgatcaacctcaccttcacctcattcgtgctggaagctcat
gttgctcagacctgccaatacgattatgtcaaactttatgatggaggcaatgaaaatgcc
aacttggttggcactttctgtggatctatagtgccagctccttttctttctaccagtaat
tccttgactctgaaatttgtcacagacaattctgtgcaaagggagggtttcagtgctacc
tacaccacagtggatcgattatgtggaggaacatataatgcaacttctacctccctaact
gcaacgtctcctaacttccccagtgaatatccaccatttactctctgtacttgggtcatt
gatgcccctccacagcagcaggtcaaggtggtggtagagaccttccacctccatcccagc
caggactgttctcagaactacctgcagctccaggacttaccaatgcacagccaaggatca
acccatagattctgtggcaatgaaacttttccagtccctgaattttattctcatgatcgc
actgccatcgtgactttcaaatcagatgaatacaggattaataatggagtcagatttacc
tatcaagcaacaggttgcagcagagagtataaccagccatttggttacctgaagagccct
ggctggcctggtcgtcaccccaataatatggattgttccatcgttctgaaggctcccctg
aatcacacgatttctctctttttccatgctttcagtttggaggacagcatccagtgttcc
catgacttcctagaggtcagaaatggaagtaatatgcaatcaccactgcttggcaggttc
tgtggaaacactgtgcccagtccaatcttcccccaaagtcatgttgttttccttcgtttc
aagagtgatgtttcaggggctcatgatggatacgaaattacttggacatcatcatcaagt
ggatgtggaggaacattatacggcagcacaggcacatttgctagtcccagattccctgca
acttactggaacaacactcattgtgagtgggtcattactgtgcccaagggacgaattgtc
acagtgaacttcgatttcatcagcattgatgacccaggggactgcagtagcaactacctg
atcctttacaatgggccagataccagctatccccaggctgggccatactgtgggatggat
acaaacattgctccattcactgctacatcgcatcaagtctacgtaaaatttcatgctgaa
tatgtgactctaccatcaggattccggttgagctggacgagctag

DBGET integrated database retrieval system