KEGG   Gallus gallus (chicken): 420533
Entry
420533            CDS       T01006                                 

Gene name
CROT
Definition
(RefSeq) peroxisomal carnitine O-octanoyltransferase
  KO
K05940  carnitine O-octanoyltransferase [EC:2.3.1.137]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    420533 (CROT)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.137  carnitine O-octanoyltransferase
     420533 (CROT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 420533
NCBI-ProteinID: XP_003640711
CGNC: 6689
Ensembl: ENSGALG00000008813
UniProt: E1BRU9
Position
2
AA seq 612 aa
MEKQVLESSEERTFQYQDSLPPLPVPPLDESLSKYLDSVKPFLNQEEYQRTEDIVKRFEN
GIGKELHQKLLERAKTRRNWLEDWWLNVAYLDLRISTQINCNMGGPGPYIEHCWPPKEGT
QIERACVNIWHTLKYWELLREEKAPIERSGNAVLDMSQFRMLFNTCKVPGITRDSLCNYF
KTVTEGECPSHLVVLCRGRVFAFDTVHEGNMLTPPELSRQLTFIQRRCDSEPDGPGLPAL
TSNERTKWAEIREYLISLDPKNLAHLEKIQQSLFVVSLDDSSPHATPEDYTEITRLGLAG
DPTVRWGDKSYNSIFFSNGTSSAFCDHSPFDAMALITMLSSAEQKIIENEGKWKGSDKVR
DIPCPEELVFTVDQKIINEIERTKEMYYEKVSDLQLACYAFTSFGKALIKKRKLHPDTFV
QLALQLAYYKCHGRPGCCYETAMTRRFYHGRTETIRPCTMEAVEWCKSMLDHSATNYERL
QLMHAAFAKHNRMRKDCENGRGFDRHLLGLLLIAQEQGLPVPELFEDPAFTASGGGGNFV
LSTSLTGYTRFSGCAVPMVHHGYGFFYAIRDDRIVVLCSSWKSCPETSAEVLCKTLFQCF
QDVLQLTVTAQL
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggaaaagcaagtgcttgagtcctctgaagagcgaacatttcagtaccaagattccctg
cctccgctgcccgtacctcctctggatgaatctttaagtaaatacctcgactcagtgaag
ccatttctaaatcaagaagaatatcaaagaaccgaggatatcgttaaaagatttgaaaat
gggattggcaaagagctgcatcagaaattactggaaagagcaaaaaccagaaggaattgg
ctggaggactggtggctgaatgtggcttaccttgatcttcgcatatcaacgcaaataaac
tgtaacatgggaggccctggtccctatattgaacactgctggccacccaaagaaggcact
cagatagagagagcatgtgtaaatatatggcacaccctgaagtactgggagctattacga
gaagagaaagcgcctatagagagatctgggaatgctgttctggacatgagccaatttcga
atgctctttaacacttgcaaggtgcctggaattaccagagactccctctgcaactatttt
aagactgtgactgaaggtgaatgcccatctcacttagtagtcctgtgtcgaggccgagtg
tttgcatttgatactgtacatgaaggcaacatgctgactcctccagagctttccaggcaa
cttacgttcatccagagaagatgcgatagtgaaccagatggaccaggactgccagcttta
acaagcaatgaaaggacaaaatgggcggagatacgtgaatatttaattagtctggaccca
aagaacctagctcatcttgaaaaaattcagcaaagtttgtttgtggtcagcctggatgat
tctagtccccatgcaactcctgaggactacacagagataacgaggctgggcctagcgggt
gatccaactgtgcgctggggagataagtcctacaacagcatattcttctccaatggaacc
tctagtgcattctgcgaccattctccttttgatgccatggctttaatcaccatgttatct
tctgctgaacaaaagattattgaaaatgaaggaaaatggaagggatcagataaagtgagg
gatattccatgcccagaggagcttgtgttcacagtagaccaaaaaattataaatgaaatt
gaacgtactaaagaaatgtattatgaaaaggtatctgacctgcagttagcgtgttacgcc
ttcacatcctttggcaaagccttgattaagaagaggaaacttcatccagatacgtttgtg
cagcttgcccttcagctggcttattacaaatgtcatgggcgcccgggctgctgttatgaa
actgcaatgaccaggcgtttctatcacggccgcacggagaccataagaccgtgtaccatg
gaagcagtagagtggtgcaaatccatgttggatcattctgccactaattatgaacgccta
cagctgatgcatgcggcatttgcaaagcacaatagaatgaggaaggattgtgagaatgga
agaggatttgaccgtcatctcctgggtctccttctcatagcacaggagcagggactgcca
gtgccagaactctttgaggaccctgccttcacagccagtggaggaggtgggaactttgtt
ctttcaactagtctgactgggtacaccagatttagtggatgtgcagtccctatggtgcat
cacggctatggctttttttatgcaatcagagatgacaggatcgttgttttatgttcttcc
tggaagtcgtgcccagagaccagtgcagaagtgctgtgcaaaactttattccagtgtttc
caggacgtgctacagttaacagttacagctcagctataa

DBGET integrated database retrieval system