KEGG   Gallus gallus (chicken): 420536
Entry
420536            CDS       T01006                                 

Gene name
DBF4
Definition
(RefSeq) protein DBF4 homolog A isoform X2
  KO
K06629  activator of S phase kinase
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    420536 (DBF4)
SSDB
Motif
Pfam: zf-DBF BRCT
Other DBs
NCBI-GeneID: 420536
NCBI-ProteinID: XP_003640712
CGNC: 6809
UniProt: E1BWF7
Position
2
AA seq 709 aa
MKPSAAEVANKGARPPDEMQAKTEKIKSSLKNVKKEVGKAEKLKYKPLTGKVFYLDIPSN
VISEKIGKDLKELGGRVESFLSKDISYLVSSKKEAKFAPTLGQISPAPSPEAVCNGGNST
PHPSNRKDRQDGSSFKAADAVRLSRGKSLAEKAIREQELIPSGSILSNALSWGVKVLHID
DVKHYIEQKKKELYLIKSTGSSFKDVGKQVTTQKSKTGRLKNPFVKVEDRSRSYRPFYLQ
LPSFPSLNYCVPKPCSPFEVDKKHPSGQKQTQYKQRNKINSDKDYRTPVQLHQKDKKRRG
YCECCGKKYEDLQTHLESEQHKNFAQSAQYQVVDDIISKFVYEFVEYKDDEKSMKRIKCS
TGYFSPIIGKITRPDELKERLKKQRISLKTYSWKDTTMQALKLDRQPAEVQPNSLLVPTP
ISASLCSILYCHLSQPPEVRSKFRNDGENTRTVCFCATNLGQSVMSPNFIHPFPQKDGKS
YMENLCQDGEPFSKETLQPEVNKKNLQSGQEGVCTLCSCTQVADFSEKDKNLAQPKRKLN
HAVVLPAKCLKKTDANPTFVEKHRDLCDNHQQMQHNVVLEAEVSESAINKELNELAANTA
HCSPSGKLHRKVKLCLGRNRRENRKQNIELCVKYADGLSVPKEKRACSSPVQTLLELFQT
SEIKSEFRGFSVYTDHEDSTGTEDVWEGQNINVVSSLFSSSSSSPFVGF
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgaaacccagcgccgcagaggtcgccaacaaaggagcgcgtcccccagatgaaatgcaa
gcaaaaacagaaaagataaaatcttccctgaagaatgtgaaaaaagaagtaggaaaagca
gagaaactgaaatataaaccactcactgggaaagtgttttacctcgatattccatcaaat
gtgatctctgaaaaaatagggaaggatcttaaagaactaggagggagagtggagagtttt
cttagcaaagatatcagctatctcgtgtccagtaaaaaggaggcaaaatttgcaccaact
cttggtcagatttctccagctcctagcccagaagctgtatgtaatggaggaaatagtaca
cctcatcccagcaaccgaaaagatcgacaggatggaagttcatttaaggccgcagatgca
gtacgtttgagcaggggaaaatccttagctgaaaaagcaatcagagagcaggaattaatc
ccctctggtagcatactgtccaatgctttgagttggggagtgaaagtacttcatattgac
gatgttaagcattacattgaacaaaagaagaaagagctctacctaatcaaaagcacaggc
agttcttttaaagatgtgggaaaacaagttactactcaaaagtcaaaaacaggtagactg
aaaaatccatttgtgaaggtggaagatagaagtcgctcctaccgaccattttatctacag
ttaccgagttttccatctctgaactactgtgttccaaaaccttgtagtccatttgaggtg
gataagaagcatccttctggtcaaaaacaaactcagtataagcaaagaaacaaaataaac
agtgacaaggactatagaactcctgttcagcttcatcagaaggacaaaaaaaggagagga
tattgtgaatgctgtgggaagaaatatgaagatctacaaactcaccttgaaagtgaacag
cacaagaactttgcacaaagcgcacagtatcaagttgttgatgatataatctccaagttt
gtttatgagtttgttgaatacaaggatgatgaaaaaagtatgaaaaggataaaatgtagt
acaggatatttttctcctattattggaaagataacaagaccagatgagctgaaagaacga
ctgaaaaagcaacgcatttcattgaaaacttactcgtggaaagatactacaatgcaggca
ctcaaactggatcgtcagcctgcagaagtacaaccaaattccttgctggtgcctacccct
atttctgcatctctgtgttcaattctttactgtcatctgtctcagcctccagaagtaaga
agtaaattcagaaatgatggcgaaaatacaagaactgtttgcttctgtgccacaaaccta
ggacagtctgtaatgtcaccaaatttcatacacccatttcctcagaaagatggtaaatca
tatatggagaacttgtgtcaagatggtgagccattcagtaaagaaacacttcaaccagaa
gtaaataaaaagaatttacagagtggtcaggaaggtgtgtgtactttgtgttcttgtact
caagtggcagattttagtgagaaggacaaaaacttagcacagcctaaacggaaattaaac
catgcagtagttctaccagcaaaatgtttgaaaaaaacagatgccaatcctacgtttgtc
gagaaacatcgtgatttatgtgataatcatcaacagatgcagcacaatgtagttctggag
gctgaggtatctgagtctgctataaacaaagaacttaatgaattggctgccaacactgca
cactgttcaccatctggaaagctgcacaggaaagtaaagctttgcttgggaagaaatagg
agagaaaaccggaaacagaatatagagttgtgtgtgaagtacgcagatggactgtctgtc
cccaaggagaaaagggcttgcagctcaccagtgcagactctgctggaattgtttcagaca
agtgaaataaaatctgaattcagaggcttttcggtttacactgatcatgaagattcaaca
ggcacggaagatgtatgggaagggcagaacataaacgttgttagttcgttattttcctct
tcatcctcatccccgtttgttggattttaa

DBGET integrated database retrieval system