KEGG   Gallus gallus (chicken): 420550
Entry
420550            CDS       T01006                                 

Gene name
ANKIB1
Definition
(RefSeq) ankyrin repeat and IBR domain-containing protein 1 isoform X1
  KO
K11967  ankyrin repeat and IBR domain-containing protein 1 [EC:2.3.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    420550 (ANKIB1)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     420550 (ANKIB1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    420550 (ANKIB1)
SSDB
Motif
Pfam: IBR Ank_5 Ank_2 Ank Ank_4 Ank_3 zf-RING_UBOX zf-C3HC4_2 zf-RING_2 zf-C3HC4_4 zf-C3HC4
Other DBs
NCBI-GeneID: 420550
NCBI-ProteinID: XP_015137444
CGNC: 7142
Ensembl: ENSGALG00000031917
Position
2
AA seq 1094 aa
MGNTTTKFRKALINGDENLACQIYESNPQLKETLDPNTSYGETYQHNTPLHYAARHGMNR
ILGTFLFVRDGNPNKRNVHNETSMHLLCMGPQIMISEGALHPRLTRPSEDDCRRADCLQM
ILKWKGAKLDEGQYERAAIDAVDNKKNTPLHYAAASGMKTCVELLVKHGGDLFAENENKD
TPCDCAEKQHHKELALNLESRMVFSRDPEAESIEAEYAALDKKEPYEGLRLQDLRRLKDM
LIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGYNAW
DTLPSPRTPRTTRSSVTSPDEISPSPGDIETAVCDICMCNISVFEDPVDMPCGHDFCRAC
WEAFLNLKIQEGEAHNIFCPAYDCFQLVPVDIIESVVSKEMDKRYLQFDIKAFVENNPAI
KWCPIPGCERAVRLTRQGSNSTGSDTLSFPMLKAPAVDCGKGHLFCWECLGEAHEPCDCQ
TWKDWLQKISEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCAK
CKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEAEKKHRRFQELDRFM
HYYTRFKNHELSYQLEQRLLKTAKEKMEQLSKALSGTEGGCPDTTFIEDAVQELLKTRRI
LKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIRAACLVQQ
KRQEFLASVARGVAPADSPEAPRRSFAGGTWDWEYLGFASPEEYAEFQYRRRHRQRRRGD
MHSLLSNTPDPDDPSESTLDTQEGGSSRRHGTSMVSSASMGILHSSSLHDYTPVSRSENQ
DSLQALSSLDEDDPNILLAIQLSLQESGLAIDEETRDFLNNEASLGAIGTSLPTRLDSAP
ISIDNPRAALSSSELLELGDSLMRLGAGSDPFSADRLHSHTCSDTRGGLYSTSSDADSSS
QDPNTNENLLGNIMAWFHDMNPQSIALIPSTSTEADEDSQQPSTEDGSAGQANVRDTGLE
LQEEHALFEDALKNEGRGTQTEEGTSEENIIPGETVSQGGDNSREVTGTLDASGDASNQT
PQTSSEWIERVHLV
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgggaaatacaaccaccaaattccgcaaagctcttataaatggagatgaaaatctggcc
tgccaaatatatgagagcaaccctcaactaaaagaaactcttgacccaaatacttcttat
ggagaaacttaccagcacaatactccactccattatgctgctaggcatggaatgaaccgt
atcctgggaactttcctttttgttagagatggtaacccgaataaacggaatgtgcacaat
gagacatctatgcacttactgtgtatgggacctcagatcatgatctcagaaggagctctt
catcctcgcctgacaagaccctccgaagatgattgcagaagagcagactgcctgcaaatg
atcttgaaatggaagggagcaaagctggatgaaggacagtatgaacgagcggccattgat
gctgttgataacaaaaaaaatacacctttgcactatgctgctgcctcagggatgaaaacc
tgtgtcgagcttttggtaaaacacggtggagatttgtttgcagaaaatgaaaataaagat
accccatgtgactgtgcagagaaacagcaccacaaagagctagctcttaacctggaatct
cgaatggtattttcacgtgatcctgaagctgaaagcattgaagctgaatatgctgcttta
gacaaaaaagagccatacgaggggctcagacttcaggatctgcggaggcttaaggatatg
ctgatagtggaaactgctgacatgcttcaagcaccactctttactgcagaagctcttctc
cgggcacatgactgggacagggagaagttgcttgaggcgtggatgtctaatccagagaac
tgctgccagcgctcgggggttcagatgcccactccccctccaagtgggtacaacgcgtgg
gatacgctgccttctccacgaactccccgcactactcgctcctctgtaacctcccctgat
gaaatcagcccgtcaccaggagacatcgagacagctgtgtgtgacatttgtatgtgtaat
atatctgtgtttgaagacccagtggatatgccttgtgggcatgacttctgcagagcatgc
tgggaggcatttttgaatctgaaaattcaggagggtgaagctcacaacattttttgccca
gcatatgattgtttccagcttgtgcctgtagacatcatagaaagtgtggtttccaaggag
atggacaaaagataccttcaatttgacattaaggcctttgttgaaaataatcctgctatt
aaatggtgtcctatcccaggctgtgaaagagcagtaaggctaacaagacaaggatcaaat
tcgacaggatcggatacgcttagcttccctatgctaaaagctcctgctgtagattgtgga
aagggacatcttttctgctgggaatgtcttggtgaagcacatgaaccttgtgactgccaa
acctggaaggactggctacagaaaatatctgaaatgaaaccagaagaacttgtgggagtt
agtgaggcatatgaagatgctgccaactgcctgtggttactaactaactccaaaccatgc
gccaactgcaaatctccaattcagaagaatgagggctgcaaccacatgcaatgtgcgaag
tgcaagtatgacttttgctggatatgcttagaagaatggaagaagcacagctcttctaca
ggaggatattacagatgtactcgctatgaggttattcagcatgtagaggaacagtccaaa
gagatgacagtagaggctgaaaagaaacataggagatttcaagaactggataggtttatg
cactattacacaaggtttaagaaccatgaacttagctaccagttagaacagcgccttcta
aaaacagccaaagaaaagatggaacagctgagtaaagctctcagtggaactgagggaggc
tgtcctgataccacattcattgaagatgcagtacaggagcttctaaaaactcgccgcatt
ctcaagtgttcttatccatatggattctttttggagcctaaaagcacaaagaaagaaata
tttgaacttatgcagacagacctggaaatggtcactgaagaccttgcacagaaagtaaac
aggccttaccttcggactcctcgccataaaatcatccgtgcagcttgtcttgtgcagcag
aagcggcaagaattcttagcctctgtggcccgtggtgttgcccctgcagactcaccagaa
gcacccaggcgcagctttgctggtggaacatgggattgggagtatttgggatttgcatcc
cctgaggaatatgctgaatttcagtatcggaggaggcacaggcagcgtcgacgtggagac
atgcacagtctgctgagtaatactccagatcccgatgaccccagtgagagtacattagac
actcaggaaggtggcagtagtagaagacatggcacttccatggtgagttcagcttctatg
ggtattctgcacagctcttcgcttcatgactatacccctgtcagtcgctctgaaaaccag
gattctctgcaggccctgagttctttggatgaagatgacccaaacatcctgctagctatt
cagttatcattacaagaatctggcttagccatagacgaagaaaccagagactttctgaat
aacgaggcatctttaggagcaatagggacctctttacctacaagactggactctgctccc
ataagtatagataacccaagagccgctttgagcagctctgagctgttagaactcggtgac
agcctgatgagactaggggcaggcagcgatcccttttcagccgatcgacttcattcacac
acctgcagtgataccagaggtggattatactcaacatctagtgatgctgattccagtagt
caagatcccaataccaatgaaaatcttcttggaaatattatggcctggtttcatgacatg
aatccacagagtattgctctgatcccttcaacaagtacagaagcggatgaggattcacag
caacccagtactgaagatgggtcagcagggcaggcaaatgttagagacacagggttggag
cttcaggaagagcacgcgctgtttgaggatgcactcaaaaatgaaggcagaggaacgcaa
acagaggaaggcacttctgaagagaacatcattccaggtgaaacagtttcacaaggtggt
gataatagcagggaagtgacaggcaccctggatgcttcaggagatgcttcaaatcagact
cctcaaacctcaagtgaatggattgaacgtgtgcatctggtatga

DBGET integrated database retrieval system