KEGG   Gallus gallus (chicken): 420580
Entry
420580            CDS       T01006                                 

Gene name
GLCCI1
Definition
(RefSeq) glucocorticoid-induced transcript 1 protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: FAM117 DUF3772
Other DBs
NCBI-GeneID: 420580
NCBI-ProteinID: NP_001012873
CGNC: 8133
Ensembl: ENSGALG00000035239
Position
2
AA seq 542 aa
MSLSSSSSQTPPSHHQPPLQRMRRCAACSPTAGGGTFGGPNNGGGAAGSSRLLQSIRATF
PFQLLRGNQHSPTRSPSASVGSNTGPGGGRGGSPPPPSSTPPLSAGGGAAEAGRVKGRQR
RSPDSGGSRRSSSPERRSPSSPVYRVDRPKSQQIRTSGTIRRTSSLDTITGPYLTGQWPR
DPHVHYPSCMKDKSTQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQS
SRHGKEKERQSPLHGNHIAVSQTQASISRSVPMPLSNISVPKSTVSRVPCNVEGISPELE
KVFIKENSGREEISKPLDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCV
SPFCPPESQDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPEGCERVK
VFEEMSSRQPVSTPLFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLTLKNSPNSGQST
ALSSLTVEQLSSRVSFSSLSDDTSTMDSTEVSVQQPSQQQQQPLLQEIQTEEHSTPQSYA
LI
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtccttgtcgtccagctcctcgcagacccccccgtcccaccaccagcccccgctgcag
aggatgaggcgttgcgccgcctgttcccccaccgccggtggcggcacgttcgggggcccc
aacaacgggggcggcgcggcggggagcagccgcctgctgcagtccatccgagccaccttc
cccttccagctactgcggggcaaccagcacagcccgacccgctccccctccgcctcggtg
ggcagcaacaccggcccgggaggggggcgaggcggcagcccgccgccccccagctccacg
ccgccgttgtcggcgggaggcggcgcggccgaggcgggcagggtgaagggccggcagcgg
cgctcgccggacagcggcggcagcaggaggagcagctcacctgagagacgcagccccagc
tccccggtgtacagagtggacaggccaaaatcccagcaaatcagaacttctggtaccata
aggcgaacttcttctttggacacaattacaggaccttacctcacaggacagtggccacgt
gatccgcatgtacactacccttcatgtatgaaagataaatctactcagacacctagctgt
tgggctgaagaaggagcagaaaagcgatcacatcagcgctcagcatcgtggggaagtgct
gatcaactaaaagagcagattgccaaactgagacagcagcttcagcgcagtaagcagagt
agtcgtcacggtaaagagaaagaacgtcaatcacctctccatggcaaccatatagcagtc
agtcagactcaggcttctatttccagatcagtccctatgccactgtcaaacatttcagtg
ccaaaatcaactgtttcacgtgtgccgtgtaatgtagaaggaataagccctgaactggaa
aaagtgttcattaaggaaaatagtggaagagaagagatatccaagcctttggatatcccc
gatggtcgaagggccccattacctgctcactatcgtagtagtagtacacgaagcattgac
actcagactccgtctgtccaggagcgcagcagcagctgcagcagccattcaccatgtgtg
tctcccttttgccctcctgaatctcaggatgggagtccttgttcaacagaagacttactc
tatgaccgtgataaagacagtgggagtagctcaccgttgcccaagtatgcctcatctccc
aaaccaaacaacagctacatgttcaaacgagagcccccagagggatgtgagcgagtgaag
gtctttgaggaaatgtcgtctcgtcagcctgtctcaacccctctcttttcatgtcctgac
aaaaacaaggttaatttcatcccaaccggatcagctttctgtcctgtaaaacttctgggc
cccctacttcccgcttcagacctgacactgaagaactctccaaactccggtcaaagcaca
gctttgagcagcctgactgttgagcagctttcgtctcgggtctctttctcatctctgtca
gatgacaccagcacaatggactctacagaggtctcggtacagcaaccatcccagcagcag
cagcagcctcttctgcaagaaattcagactgaagagcattccactcctcagagctacgcg
ctaatctag

DBGET integrated database retrieval system