KEGG   Gallus gallus (chicken): 420596
Entry
420596            CDS       T01006                                 

Gene name
AGR2
Definition
(RefSeq) anterior gradient protein 2 homolog
  KO
K20356  anterior gradient protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    420596 (AGR2)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    420596 (AGR2)
SSDB
Motif
Pfam: Thioredoxin_7 Thioredoxin_2
Other DBs
NCBI-GeneID: 420596
NCBI-ProteinID: XP_418698
CGNC: 8224
Ensembl: ENSGALG00000010825
UniProt: E1C937
Position
2
AA seq 172 aa
MEKSYMSMFLLLMAISCVLAKDIGKKETKETSTKPKLPQTLSRGWGDQLIWTQTYEEALF
RSKNSNKPLMIIHHLDDCPHSQALKKVFAEHKEIQKLAEKFILLNLVYETTDKNLAPDGQ
YVPRILFIDPSLTVRADITGRYSNRLYAYEPSDISLLYSNMQKALKLLKTEL
NT seq 519 nt   +upstreamnt  +downstreamnt
atggagaagagctacatgtccatgttcctgctgctcatggccatctcttgtgttttggca
aaagatataggcaagaaggagacgaaggagactagcactaaaccaaaactgcctcaaaca
ctctccagaggctggggggaccagctcatctggacgcagacgtatgaggaagccctcttc
cgctccaagaacagcaataaacccctgatgattatccaccacctggatgactgcccacac
agccaagcactcaagaaggtctttgctgaacataaggaaatacagaaattggctgaaaaa
ttcattctcctgaaccttgtgtacgaaaccacagacaagaaccttgcacctgatggccag
tacgtccctcggattttgttcattgatccttccctgactgtgagagcagacattactgga
agatactcaaaccgtctgtatgcatatgagccctctgacatttctctgttgtattcaaat
atgcagaaagcactgaagctgctgaagactgagctgtaa

DBGET integrated database retrieval system