KEGG   Gallus gallus (chicken): 420624Help
Entry
420624            CDS       T01006                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
gga  Gallus gallus (chicken)
Pathway
gga04115  p53 signaling pathway
gga04210  Apoptosis
gga05164  Influenza A
gga05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    420624 (CYCS)
   04115 p53 signaling pathway
    420624 (CYCS)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    420624 (CYCS)
   05168 Herpes simplex infection
    420624 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 420624
NCBI-ProteinID: NP_001072946
CGNC: 8375
Ensembl: ENSGALG00000011020
UniProt: P67881
Position
2
AA seq 105 aa AA seqDB search
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatattgagaagggcaagaagatttttgtccagaaatgttcccagtgccatacg
gttgaaaaaggaggcaagcacaagactggacccaaccttcatggcctgtttggacgcaaa
acaggacaagctgagggcttctcttacacagatgccaataagaacaaaggtatcacttgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtacatcccaggaacaaag
atgatttttgcgggtatcaagaagaagtctgagagagtagacttaatagcatatctcaaa
gatgccacttcaaagtaa

DBGET integrated database retrieval system