KEGG   Gallus gallus (chicken): 420633Help
Entry
420633            CDS       T01006                                 

Gene name
JAZF1
Definition
(RefSeq) juxtaposed with another zinc finger protein 1
  KO
K19495  juxtaposed with another zinc finger protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    420633 (JAZF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_aberr zf-C2H2 zf-C2H2_4 FOXP-CC zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 420633
NCBI-ProteinID: NP_001186547
CGNC: 8448
Ensembl: ENSGALG00000030455
UniProt: A0A1D5PFG7
Position
2
AA seq 243 aa AA seqDB search
MTGIAAASFFSNACRFGGCGLHFPTLAELIEHIEDNHIDTDPRVLEKQELQQPTYVALSY
INRFMTDAARREQESLKKKIQPKLSLTLSSTVSRGNVSTPPRHSSGSLTPPVTPPITPSS
SFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGDEKPFACPVPGC
KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRK
MQQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcatcgccgccgcctccttcttctccaacgcctgcaggttcgggggctgcggg
ctgcacttcccgaccctggcggagctcatcgagcacatcgaggacaaccacatcgataca
gacccacgtgtattagagaaacaagaacttcagcagccaacctatgttgctctaagttac
attaacaggtttatgactgatgcagctcgacgtgagcaggagtctttgaagaagaagatt
cagccgaaactctctttgactttgtcaagcacggtgtcccgtgggaatgtatccactcca
cctcgccacagcagtggaagccttactcctcccgtcacccctccaatcactccttcctct
tcatttcgtagcagtactccaacaggtagtgaatatgatgaggaggaagtagactatgaa
gaatctgacagcgatgagtcctggactacagaaagtgctatcagctctgaagctatcctt
agttcaatgtgcatgaatggcggggacgagaaacctttcgcctgtcctgttcctggatgt
aaaaaaagatataagaatgtgaacggcatcaagtaccacgccaagaatggccacagaaca
caaatccgcgtacgcaaacccttcaaatgtcgctgcggaaagagttacaagacagctcag
ggcctgcggcaccacacaatcaatttccacccccccgtgtctgctgagattatcaggaag
atgcagcaataa

DBGET integrated database retrieval system